DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BSG and DIP-eta

DIOPT Version :9

Sequence 1:NP_001719.2 Gene:BSG / 682 HGNCID:1116 Length:385 Species:Homo sapiens
Sequence 2:NP_001188701.2 Gene:DIP-eta / 33793 FlyBaseID:FBgn0031725 Length:450 Species:Drosophila melanogaster


Alignment Length:319 Identity:69/319 - (21%)
Similarity:118/319 - (36%) Gaps:71/319 - (22%)


- Green bases have known domain annotations that are detailed below.


Human    87 QHAASTISIDTLVEEDTGTYECRASNDPDRNHLTRAPRVKWVRAQAVVLVLEPGTV-FTTVEDL- 149
            :|...|:.|..:.|.|.|.|.|:.:.||.::.:           ..:.:|:.|..: :.|..|: 
  Fly   104 EHKTWTMRIKDIKESDKGWYMCQINTDPMKSQM-----------GYLDVVVPPDILDYPTSTDMV 157

Human   150 ---GSKILLTCSLNDS-ATEVTGHRWLKGGVVLK----EDALPGQKTEFKVDS--DDQWGEYSCV 204
               ||.:.|.|:...| ...:|..|  :.||.::    |:.:..:.|:..:.:  ....|.|.|:
  Fly   158 VREGSNVTLKCAATGSPEPTITWRR--ESGVPIELATGEEVMSIEGTDLVIPNVRRHHMGAYLCI 220

Human   205 ----FLPEPMGTANIQLHGPPRVKAVKSSEHINEGETAMLVCKSESVPPVTDWAWYK----ITDS 261
                ..|.......:.:|.||.:..........||:...|.|:||:.|...:: |.:    |...
  Fly   221 ASNGVPPSVSKRITLVVHFPPMITVQNQLIGAVEGKGVTLDCESEAYPKSINY-WTRERGEIVPP 284

Human   262 EDKALMNGSESRFFVSSSQGRSELHIENLNMEADPGQYRCNGTSSKGSDQAIITL-RVRSHLAAL 325
            ..|...|.:|    :...:....|||..|. :|:.|.|||...:|.|.....|.| |:..:    
  Fly   285 GGKYSANVTE----IGGYRNSMRLHINPLT-QAEFGSYRCVAKNSLGDTDGTIKLYRIPPN---- 340

Human   326 WPFLGIVAEVLVLVTIIFIYEKRRKPEDVLDDDDAGSAPLKSSGQH-----QNDKGKNV 379
                        .|..:..:|.|.|          |....|||..|     |...|:::
  Fly   341 ------------AVNYVENFEARHK----------GKKRTKSSESHHPARAQEHSGEDM 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BSGNP_001719.2 IG_like 29..113 CDD:214653 8/25 (32%)
Ig 40..114 CDD:143165 8/26 (31%)
Essential for interaction with KDR/VEGFR2. /evidence=ECO:0000269|PubMed:25825981 195..199 0/3 (0%)
Ig 219..317 CDD:299845 27/102 (26%)
IG_like 228..318 CDD:214653 25/94 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 353..385 7/32 (22%)
DIP-etaNP_001188701.2 Ig 51..141 CDD:299845 10/47 (21%)
IG_like 51..137 CDD:214653 10/43 (23%)
IG_like 153..237 CDD:214653 16/85 (19%)
Ig 161..224 CDD:299845 14/64 (22%)
IG_like 252..335 CDD:214653 24/88 (27%)
Ig 258..333 CDD:143165 21/80 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.