DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rnf13 and DMA2

DIOPT Version :9

Sequence 1:NP_001102914.1 Gene:Rnf13 / 681578 RGDID:1594062 Length:380 Species:Rattus norvegicus
Sequence 2:NP_014283.3 Gene:DMA2 / 855607 SGDID:S000005060 Length:522 Species:Saccharomyces cerevisiae


Alignment Length:94 Identity:28/94 - (29%)
Similarity:50/94 - (53%) Gaps:8/94 - (8%)


- Green bases have known domain annotations that are detailed below.


  Rat   214 RRNRLRKDQLKKLP-VHKFKKGDEYDVCAICLEEYEDGDKLRILPCSHAYHCKCVD--PWLTKTK 275
            :.|...|:.|::|. :.|...|.|.:.|:|||.:.:....:.|.||:|::|.:||.  ..|:..:
Yeast   406 KANSFNKEALQRLQNLQKLTTGIEEEDCSICLCKIKPCQAIFISPCAHSWHFRCVRRLVMLSYPQ 470

  Rat   276 KTCPVCKQKVVPSQGDSDSDTDSSQEENQ 304
            ..||.|:     |..|.::..:||.||::
Yeast   471 FVCPNCR-----SSCDLEASFESSDEEDE 494

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rnf13NP_001102914.1 PA_C_RZF_like 23..180 CDD:239038
RING-H2_RNF167 238..283 CDD:319711 15/46 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 285..380 6/20 (30%)
DMA2NP_014283.3 FHA 228..417 CDD:224630 3/10 (30%)
RING-H2_Dmap_like 431..477 CDD:319372 14/45 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X670
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.