DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rnf13 and Rnf13

DIOPT Version :9

Sequence 1:NP_001102914.1 Gene:Rnf13 / 681578 RGDID:1594062 Length:380 Species:Rattus norvegicus
Sequence 2:NP_001106884.1 Gene:Rnf13 / 24017 MGIID:1346341 Length:381 Species:Mus musculus


Alignment Length:381 Identity:377/381 - (98%)
Similarity:378/381 - (99%) Gaps:1/381 - (0%)


- Green bases have known domain annotations that are detailed below.


  Rat     1 MLLSIGMLMLSATQVYTILTVQLFAFLNLLPVEADILAYNFENASQTFEDLPARFGYRLPAEGLK 65
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Mouse     1 MLLSIGMLMLSATQVYTILTVQLFAFLNLLPVEADILAYNFENASQTFEDLPARFGYRLPAEGLK 65

  Rat    66 GFLINSKPENACEPIVPPPLKDNSSGTFIVLIRRLDCNFDIKVLNAQRAGYKAAIVHNVDSDDLI 130
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Mouse    66 GFLINSKPENACEPIVPPPLKDNSSGTFIVLIRRLDCNFDIKVLNAQRAGYKAAIVHNVDSDDLI 130

  Rat   131 SMGSNDIDILKKIDIPSVFIGESSANSLKDEFTYEKGGHVILVPELSLPLEYYLIPFLIIVGICL 195
            ||||||||.||||||||||||||||||||||||||||||:|||||||||||||||||||||||||
Mouse   131 SMGSNDIDTLKKIDIPSVFIGESSANSLKDEFTYEKGGHIILVPELSLPLEYYLIPFLIIVGICL 195

  Rat   196 ILIVIFMITKFVQDRHRNRRNRLRKDQLKKLPVHKFKKGDEYDVCAICLEEYEDGDKLRILPCSH 260
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Mouse   196 ILIVIFMITKFVQDRHRNRRNRLRKDQLKKLPVHKFKKGDEYDVCAICLEEYEDGDKLRILPCSH 260

  Rat   261 AYHCKCVDPWLTKTKKTCPVCKQKVVPSQGDSDSDTDSSQEENQVSEHTPLLPPSASARTQSFGS 325
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Mouse   261 AYHCKCVDPWLTKTKKTCPVCKQKVVPSQGDSDSDTDSSQEENQVSEHTPLLPPSASARTQSFGS 325

  Rat   326 LSESHSHH-MTESSDYEDDDNEETDSSDADNEITDHSVVVQLQPNGEPDYNIANTV 380
            |||||||| ||||||||||||||||||||||||||||||||||||||.||||||||
Mouse   326 LSESHSHHNMTESSDYEDDDNEETDSSDADNEITDHSVVVQLQPNGEQDYNIANTV 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rnf13NP_001102914.1 PA_C_RZF_like 23..180 CDD:239038 154/156 (99%)
RING-H2_RNF167 238..283 CDD:319711 44/44 (100%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 285..380 93/95 (98%)
Rnf13NP_001106884.1 PA_C_RZF_like 23..180 CDD:239038 154/156 (99%)
RING-H2_RNF167 238..283 CDD:319711 44/44 (100%)
RING-H2 finger (C3H2C3-type) 240..281 CDD:319711 40/40 (100%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 285..381 95/97 (98%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 193 1.000 Domainoid score I29435
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 759 1.000 Inparanoid score I9442
OMA 1 1.010 - - QHG51404
OrthoDB 1 1.010 - - D1487241at2759
OrthoFinder 1 1.000 - - FOG0001489
OrthoInspector 1 1.000 - - oto178638
orthoMCL 1 0.900 - - OOG6_103040
Panther 1 1.100 - - LDO PTHR22765
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X670
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1211.980

Return to query results.
Submit another query.