DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment STYX and Mkp3

DIOPT Version :9

Sequence 1:NP_001124173.1 Gene:STYX / 6815 HGNCID:11447 Length:223 Species:Homo sapiens
Sequence 2:NP_001262031.1 Gene:Mkp3 / 40081 FlyBaseID:FBgn0036844 Length:497 Species:Drosophila melanogaster


Alignment Length:146 Identity:49/146 - (33%)
Similarity:84/146 - (57%) Gaps:12/146 - (8%)


- Green bases have known domain annotations that are detailed below.


Human    31 EILPG-LFLGPYSSAMKSKLPVLQKHGITHIICIRQNIEANFIKPN-FQQL--FRYLVLDIADNP 91
            ||:|| ||||..:.:..|:  .|:|:.|.:::.:..::      || |::.  .:||.:.|.|:.
  Fly   217 EIIPGLLFLGNATHSCDSE--ALKKYNIKYVLNVTPDL------PNKFKESGDIKYLQIPITDHY 273

Human    92 VENIIRFFPMTKEFIDGSLQMGGKVLVHGNAGISRSAAFVIAYIMETFGMKYRDAFAYVQERRFC 156
            .:::...||...:||:.:......||||..||:|||....:||:|.|.|:...||||.|::|:..
  Fly   274 SQDLAIHFPDAIQFIEEARSASSVVLVHCLAGVSRSVTVTLAYLMHTRGLSLNDAFAMVRDRKPD 338

Human   157 INPNAGFVHQLQEYEA 172
            ::||..|:.||..:|:
  Fly   339 VSPNFHFMQQLLSFES 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
STYXNP_001124173.1 DSP_STYX 25..175 CDD:350372 49/146 (34%)
Interaction with FBXW7. /evidence=ECO:0000269|PubMed:28007894 76..78 1/1 (100%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 197..223
Mkp3NP_001262031.1 DSP_MapKP 8..148 CDD:238723
DSPc 215..353 CDD:238073 48/143 (34%)
CDC14 <242..359 CDD:225297 38/119 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.