DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment STYX and CG10089

DIOPT Version :9

Sequence 1:NP_001124173.1 Gene:STYX / 6815 HGNCID:11447 Length:223 Species:Homo sapiens
Sequence 2:NP_001261803.1 Gene:CG10089 / 39517 FlyBaseID:FBgn0036369 Length:447 Species:Drosophila melanogaster


Alignment Length:153 Identity:51/153 - (33%)
Similarity:82/153 - (53%) Gaps:8/153 - (5%)


- Green bases have known domain annotations that are detailed below.


Human    25 MRREMQEILPGLFLGPYSSAMKSKLPVLQKHGITHIICIRQNIEANFIKPNFQQLFRYLVLDIAD 89
            |...|.::||||::|.|..:...  ..|::..|:|||.|..:  ...:.|:    ..||.:..:|
  Fly     1 MNWHMGKVLPGLYVGNYRDSKDH--AQLERFKISHIIAIHDS--PRRLLPD----KHYLCVMASD 57

Human    90 NPVENIIRFFPMTKEFIDGSLQMGGKVLVHGNAGISRSAAFVIAYIMETFGMKYRDAFAYVQERR 154
            .|.:|:.::|.:..:||..:....|.||:|..||:|||....:||||....:.:::|...|:..|
  Fly    58 TPDQNLSQYFSVCNDFIHAARLREGNVLIHCLAGMSRSVTVAVAYIMTATHLNWKEALKVVRAGR 122

Human   155 FCINPNAGFVHQLQEYEAIYLAK 177
            ...||||||..||||:|...|::
  Fly   123 AVANPNAGFQSQLQEFEQFKLSE 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
STYXNP_001124173.1 DSP_STYX 25..175 CDD:350372 50/149 (34%)
Interaction with FBXW7. /evidence=ECO:0000269|PubMed:28007894 76..78 0/1 (0%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 197..223
CG10089NP_001261803.1 DSPc 4..139 CDD:238073 48/142 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1042
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.