powered by:
Protein Alignment Rnf148 and APE3
DIOPT Version :9
Sequence 1: | NP_001178011.1 |
Gene: | Rnf148 / 681407 |
RGDID: | 1595417 |
Length: | 316 |
Species: | Rattus norvegicus |
Sequence 2: | NP_009845.2 |
Gene: | APE3 / 852589 |
SGDID: | S000000490 |
Length: | 537 |
Species: | Saccharomyces cerevisiae |
Alignment Length: | 61 |
Identity: | 21/61 - (34%) |
Similarity: | 32/61 - (52%) |
Gaps: | 1/61 - (1%) |
- Green bases have known domain annotations that are detailed below.
Rat 108 PDQADSWLALIERGGCTFTHKINVAAEKGANGVIIY-NYPGTGNKVFPMSHQGTENIVAVM 167
|...:..:||||||.|.|..|.|:|.:.|...|:|| |.|.:...:.....:.|::.||.:
Yeast 198 PRHNEKQIALIERGKCPFGDKSNLAGKFGFTAVVIYDNEPKSKEGLHGTLGEPTKHTVATV 258
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.