DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Rnf148 and APE3

DIOPT Version :9

Sequence 1:	NP_001178011.1	Gene:	Rnf148 / 681407	RGDID:	1595417	Length:	316	Species:	Rattus norvegicus
Sequence 2:	NP_009845.2	Gene:	APE3 / 852589	SGDID:	S000000490	Length:	537	Species:	Saccharomyces cerevisiae

Alignment Length:	61	Identity:	21/61 - (34%)
Similarity:	32/61 - (52%)	Gaps:	1/61 - (1%)

- Green bases have known domain annotations that are detailed below.

  Rat   108 PDQADSWLALIERGGCTFTHKINVAAEKGANGVIIY-NYPGTGNKVFPMSHQGTENIVAVM 167
            |...:..:||||||.|.|..|.|:|.:.|...|:|| |.|.:...:.....:.|::.||.:
Yeast   198 PRHNEKQIALIERGKCPFGDKSNLAGKFGFTAVVIYDNEPKSKEGLHGTLGEPTKHTVATV 258

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Rnf148	NP_001178011.1	PA_GRAIL_like	56..190	CDD:239037	21/61 (34%)
Rnf148	NP_001178011.1	zf-RING_2	267..310	CDD:290367
APE3	NP_009845.2	M28_SGAP_like	78..506	CDD:349873	21/61 (34%)
APE3	NP_009845.2	PA_ScAPY_like	155..284	CDD:239045	21/61 (34%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910