DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rnf148 and H10E21.5

DIOPT Version :9

Sequence 1:NP_001178011.1 Gene:Rnf148 / 681407 RGDID:1595417 Length:316 Species:Rattus norvegicus
Sequence 2:NP_497129.1 Gene:H10E21.5 / 175169 WormBaseID:WBGene00019185 Length:473 Species:Caenorhabditis elegans


Alignment Length:112 Identity:48/112 - (42%)
Similarity:70/112 - (62%) Gaps:4/112 - (3%)


- Green bases have known domain annotations that are detailed below.


  Rat   205 MSLFTFLAATVAYLFLYCAWRPRAPNSSTRRQRQIKSDVKKAIGQLQLRVLKEG-DKELDPNEDS 268
            :|....:..::|:|..|...|.|..::..|.||::.:..:||:.::....:..| .:||   :..
 Worm   165 ISFIILMVISLAWLVFYYVQRFRYAHAKDRLQRRLFNAARKALTRIPTMTITPGMTQEL---QSD 226

  Rat   269 CVVCFDIYKAQDVIRILTCKHFFHKTCIDPWLLAHRTCPMCKCDILR 315
            |.||.|.|:.|||||:|.|||.:||:|||||||.||||||||.|||:
 Worm   227 CAVCLDPYQLQDVIRLLPCKHIYHKSCIDPWLLEHRTCPMCKNDILK 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rnf148NP_001178011.1 PA_GRAIL_like 56..190 CDD:239037
zf-RING_2 267..310 CDD:290367 29/42 (69%)
H10E21.5NP_497129.1 HRD1 <150..325 CDD:227568 48/112 (43%)
RING-H2_GRAIL 226..273 CDD:319582 33/46 (72%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm18729
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22765
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
54.970

Return to query results.
Submit another query.