DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rnf133 and SPAC57A7.09

DIOPT Version :9

Sequence 1:NP_001037743.1 Gene:Rnf133 / 681395 RGDID:1596695 Length:381 Species:Rattus norvegicus
Sequence 2:NP_593372.1 Gene:SPAC57A7.09 / 2542187 PomBaseID:SPAC57A7.09 Length:372 Species:Schizosaccharomyces pombe


Alignment Length:247 Identity:58/247 - (23%)
Similarity:91/247 - (36%) Gaps:76/247 - (30%)


- Green bases have known domain annotations that are detailed below.


  Rat   104 LIERGGCAFTQKIKVASENGARGVIIYNFPGTGNQVFPMSHQAFEDIVVVMIGNVKGMEILHLIR 168
            |::||.|.:..|...|...|.:|||:      |:...|.|.:....:....:...|         
pombe   146 LVQRGKCTYFDKALEAQRLGFKGVIV------GDNRSPSSFRLHYMVAPDKVDESK--------- 195

  Rat   169 KGVHV-TVMVEVGRKHVIW-------------------LNHYFVSF---------MIVTTATLA- 203
              ||: ::.|.....:::|                   |...|..|         |::|...|| 
pombe   196 --VHIPSLFVSTSSYNLLWSDLLHSYRQPLKLYAKPEELGDMFWPFLLCFSPSIIMLITVQALAI 258

  Rat   204 ------YFTFYHIRRLWVARIEDRRWKRLTRELKKAF-------------GQLQVRILKEGDEEV 249
                  |.|....||.    |||...:.::||   .|             |:| |.::.|.....
pombe   259 RKFIRTYRTKSKTRRF----IEDLPSRTISRE---GFYSEEEEIENSTQNGEL-VPLMDESTRRA 315

  Rat   250 SPNADSCVICFEAYKPNEIVRILTCKHFFHKNCIDPWILAH-GTCPMCKCDI 300
            :...: ||||.|::...:.|..|.|||.||:.||..||:.: ..||.|..::
pombe   316 TFGVE-CVICLESFTKGDKVVALPCKHEFHRPCIAKWIVDYRHACPTCNTEV 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rnf133NP_001037743.1 PA_GRAIL_like 43..177 CDD:239037 16/73 (22%)
HRD1 <183..>368 CDD:227568 41/167 (25%)
RING-H2_RNF128_like 254..302 CDD:319716 19/48 (40%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 340..381
SPAC57A7.09NP_593372.1 COG5540 1..369 CDD:227827 58/247 (23%)
Peptidases_S8_S53 <144..211 CDD:299169 17/81 (21%)
zf-RING_2 320..362 CDD:290367 18/42 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm64279
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.