Sequence 1: | NP_001037743.1 | Gene: | Rnf133 / 681395 | RGDID: | 1596695 | Length: | 381 | Species: | Rattus norvegicus |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_593372.1 | Gene: | SPAC57A7.09 / 2542187 | PomBaseID: | SPAC57A7.09 | Length: | 372 | Species: | Schizosaccharomyces pombe |
Alignment Length: | 247 | Identity: | 58/247 - (23%) |
---|---|---|---|
Similarity: | 91/247 - (36%) | Gaps: | 76/247 - (30%) |
- Green bases have known domain annotations that are detailed below.
Rat 104 LIERGGCAFTQKIKVASENGARGVIIYNFPGTGNQVFPMSHQAFEDIVVVMIGNVKGMEILHLIR 168
Rat 169 KGVHV-TVMVEVGRKHVIW-------------------LNHYFVSF---------MIVTTATLA- 203
Rat 204 ------YFTFYHIRRLWVARIEDRRWKRLTRELKKAF-------------GQLQVRILKEGDEEV 249
Rat 250 SPNADSCVICFEAYKPNEIVRILTCKHFFHKNCIDPWILAH-GTCPMCKCDI 300 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Rnf133 | NP_001037743.1 | PA_GRAIL_like | 43..177 | CDD:239037 | 16/73 (22%) |
HRD1 | <183..>368 | CDD:227568 | 41/167 (25%) | ||
RING-H2_RNF128_like | 254..302 | CDD:319716 | 19/48 (40%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 340..381 | ||||
SPAC57A7.09 | NP_593372.1 | COG5540 | 1..369 | CDD:227827 | 58/247 (23%) |
Peptidases_S8_S53 | <144..211 | CDD:299169 | 17/81 (21%) | ||
zf-RING_2 | 320..362 | CDD:290367 | 18/42 (43%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 1 | 1.000 | - | - | otm64279 | |
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.910 |