DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hist1h2bc and His2B:CG33868

DIOPT Version :9

Sequence 1:XP_038952337.1 Gene:Hist1h2bc / 680403 RGDID:1591796 Length:134 Species:Rattus norvegicus
Sequence 2:NP_001027385.1 Gene:His2B:CG33868 / 3772265 FlyBaseID:FBgn0053868 Length:123 Species:Drosophila melanogaster


Alignment Length:128 Identity:103/128 - (80%)
Similarity:107/128 - (83%) Gaps:9/128 - (7%)


- Green bases have known domain annotations that are detailed below.


  Rat     1 MPEPAKSAPAPKKGSKKAVTKAQK---KDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGI 62
            || |..|..|.||..     ||||   |..||:||.|||||::|:||||||||||||||||||.|
  Fly     1 MP-PKTSGKAAKKAG-----KAQKNITKTDKKKKRKRKESYAIYIYKVLKQVHPDTGISSKAMSI 59

  Rat    63 MNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSS 125
            |||||||||||||.|||||||||||||||||||||||||||||||||||||||||||||||||
  Fly    60 MNSFVNDIFERIAAEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSS 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hist1h2bcXP_038952337.1 H2B 28..123 CDD:197718 87/94 (93%)
His2B:CG33868NP_001027385.1 H2B 33..121 CDD:197718 82/87 (94%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 143 1.000 Domainoid score I4523
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 191 1.000 Inparanoid score I3779
OMA 1 1.010 - - QHG53922
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000065
OrthoInspector 1 1.000 - - otm44705
orthoMCL 1 0.900 - - OOG6_100082
Panther 1 1.100 - - O PTHR23428
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X77
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1110.970

Return to query results.
Submit another query.