DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2ac12 and His2A:CG33832

DIOPT Version :9

Sequence 1:XP_008769989.1 Gene:H2ac12 / 680322 RGDID:1593006 Length:168 Species:Rattus norvegicus
Sequence 2:NP_001027331.1 Gene:His2A:CG33832 / 3772632 FlyBaseID:FBgn0053832 Length:124 Species:Drosophila melanogaster


Alignment Length:122 Identity:108/122 - (88%)
Similarity:114/122 - (93%) Gaps:1/122 - (0%)


- Green bases have known domain annotations that are detailed below.


  Rat    41 MSGRGKQGSKARAKAKTRSFRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILE 105
            |||||| |.|.:.|||:||.||||||||||:|||||||||:||||||||||||||:|||.||:||
  Fly     1 MSGRGK-GGKVKGKAKSRSNRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEVLE 64

  Rat   106 LAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKKTE 162
            |||||||||||||||||||||||||||||||||..||||||||||||||||||||||
  Fly    65 LAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPKKTE 121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2ac12XP_008769989.1 PTZ00017 41..163 CDD:185399 108/122 (89%)
H2A 46..160 CDD:238029 99/113 (88%)
His2A:CG33832NP_001027331.1 PTZ00017 16..124 CDD:185399 97/106 (92%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.