DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AURKA and aurA

DIOPT Version :9

Sequence 1:XP_016883523.1 Gene:AURKA / 6790 HGNCID:11393 Length:437 Species:Homo sapiens
Sequence 2:NP_476749.1 Gene:aurA / 41446 FlyBaseID:FBgn0000147 Length:411 Species:Drosophila melanogaster


Alignment Length:412 Identity:199/412 - (48%)
Similarity:265/412 - (64%) Gaps:38/412 - (9%)


- Green bases have known domain annotations that are detailed below.


Human    37 RSKENCISG-PVKATAPVGGPKRVLVTQQ------FPCQNPLPVNSGQAQRV--LCPSNSSQRIP 92
            |.|||.... |.|:.|.....|.:|:.::      .|...|||.:||...|.  |..|||     
  Fly    10 RPKENAPHRMPEKSAAVHNMQKNLLLGKKPNSENMAPASKPLPGSSGALIRKPGLGGSNS----- 69

Human    93 LQAQKLVSS-----HKPVQNQKQKQLQATSVPHPVSRPLNNTQKSKQPLPSAPENNPEEEL---- 148
                 :.||     .||:....:|.....:.|.||: |:...:...:..|:|..:...:||    
  Fly    70 -----IASSEGNNFQKPMVPSVKKTTSEFAAPAPVA-PIKKPESLSKQKPTAASSESSKELGAAS 128

Human   149 --ASKQKNE-----ESKKRQWALEDFEIGRPLGKGKFGNVYLAREKQSKFILALKVLFKAQLEKA 206
              |.|:|.:     :..|:.|.|.:|:|||.||:||||||||||||:|:|::|||||||.|:.::
  Fly   129 SSAEKEKTKTETQPQKPKKTWELNNFDIGRLLGRGKFGNVYLAREKESQFVVALKVLFKRQIGES 193

Human   207 GVEHQLRREVEIQSHLRHPNILRLYGYFHDATRVYLILEYAPLGTVYREL--QKLSKFDEQRTAT 269
            .||||:|||:|||||||||:|||||.||||..|:||||||||.||::..|  |.:.:|||:::||
  Fly   194 NVEHQVRREIEIQSHLRHPHILRLYAYFHDDVRIYLILEYAPQGTLFNALQAQPMKRFDERQSAT 258

Human   270 YITELANALSYCHSKRVIHRDIKPENLLLGSAGELKIADFGWSVHAPSSRRTTLCGTLDYLPPEM 334
            ||..|.:||.|.|.:.:|||||||||||||..|.|||||||||||.|:|.|.|||||:|||||||
  Fly   259 YIQALCSALLYLHERDIIHRDIKPENLLLGHKGVLKIADFGWSVHEPNSMRMTLCGTVDYLPPEM 323

Human   335 IEGRMHDEKVDLWSLGVLCYEFLVGKPPFEANTYQETYKRISRVEFTFPDFVTEGARDLISRLLK 399
            ::|:.|.:.||||||||||:|.|||..||.:..|.||||:|.:|::..|:.:::.|..|||:||.
  Fly   324 VQGKPHTKNVDLWSLGVLCFELLVGHAPFYSKNYDETYKKILKVDYKLPEHISKAASHLISKLLV 388

Human   400 HNPSQRPMLREVLEHPWITANS 421
            .||..|..|.:|:.||||.|::
  Fly   389 LNPQHRLPLDQVMVHPWILAHT 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AURKAXP_016883523.1 None
aurANP_476749.1 STKc_Aurora 153..407 CDD:270909 158/253 (62%)
S_TKc 154..406 CDD:214567 157/251 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145652
Domainoid 1 1.000 336 1.000 Domainoid score I1120
eggNOG 1 0.900 - - E1_KOG0580
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H2670
Inparanoid 1 1.050 363 1.000 Inparanoid score I2178
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D318112at33208
OrthoFinder 1 1.000 - - FOG0000946
OrthoInspector 1 1.000 - - otm40694
orthoMCL 1 0.900 - - OOG6_100573
Panther 1 1.100 - - O PTHR24350
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X555
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1312.800

Return to query results.
Submit another query.