DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AURKA and aurB

DIOPT Version :9

Sequence 1:XP_016883523.1 Gene:AURKA / 6790 HGNCID:11393 Length:437 Species:Homo sapiens
Sequence 2:NP_477336.1 Gene:aurB / 34504 FlyBaseID:FBgn0024227 Length:329 Species:Drosophila melanogaster


Alignment Length:335 Identity:145/335 - (43%)
Similarity:217/335 - (64%) Gaps:20/335 - (5%)


- Green bases have known domain annotations that are detailed below.


Human   109 KQKQLQATSVPHPVSRPLNNTQKSKQPLPSAPENN--PEEELASKQKNEES--KKRQWALEDFEI 169
            :.|......:||.:::              .||.:  |.:.:..|..:.::  :...|:..|||:
  Fly     5 RAKHANRNHLPHLLAK--------------VPEEHQEPIKNMCLKMMSHDAYGQPYDWSPRDFEM 55

Human   170 GRPLGKGKFGNVYLAREKQSKFILALKVLFKAQLEKAGVEHQLRREVEIQSHLRHPNILRLYGYF 234
            |..||:||||.||||||:.|.:::|:||:||.:|.|..|:.|:.||:||||.|:||:||||..:|
  Fly    56 GAHLGRGKFGRVYLARERHSHYLVAMKVMFKEELRKGCVQRQVLREIEIQSRLKHPHILRLLTWF 120

Human   235 HDATRVYLILEYAPLGTVYRELQKL--SKFDEQRTATYITELANALSYCHSKRVIHRDIKPENLL 297
            ||.:|:||.||.|..|.:::.|:..  .:|||.|:|.|..::||||:|||...|||||:||||:|
  Fly   121 HDESRIYLALEIASEGELFKHLRGAPNHRFDEPRSAKYTYQVANALNYCHLNNVIHRDLKPENIL 185

Human   298 LGSAGELKIADFGWSVHAPSSRRTTLCGTLDYLPPEMIEGRMHDEKVDLWSLGVLCYEFLVGKPP 362
            |.|..:||:||||||.|.|:::|.|||||||||||||::|..:|:.||.|.||:|||||:||.||
  Fly   186 LTSTDDLKLADFGWSAHTPNNKRRTLCGTLDYLPPEMVDGNSYDDSVDQWCLGILCYEFVVGCPP 250

Human   363 FEANTYQETYKRISRVEFTFPDFVTEGARDLISRLLKHNPSQRPMLREVLEHPWITANSSKPSNC 427
            ||:|:.:.||.:|.|:|.::|..:::|.::||..||:.....|..|.:|:.|.|:.|..::....
  Fly   251 FESNSTESTYSKIRRMEISYPSHLSKGCKELIGGLLRKESKGRITLVDVMTHYWVKAGMAERELQ 315

Human   428 QNKESASKQS 437
            ..|....|::
  Fly   316 LQKRERGKEN 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AURKAXP_016883523.1 None
aurBNP_477336.1 STKc_Aurora 52..306 CDD:270909 134/253 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D318112at33208
OrthoFinder 1 1.000 - - FOG0000946
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100573
Panther 1 1.100 - - O PTHR24350
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X555
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.820

Return to query results.
Submit another query.