DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment STK3 and Dsor1

DIOPT Version :10

Sequence 1:XP_016869245.1 Gene:STK3 / 6788 HGNCID:11406 Length:580 Species:Homo sapiens
Sequence 2:NP_511098.1 Gene:Dsor1 / 31872 FlyBaseID:FBgn0010269 Length:396 Species:Drosophila melanogaster


Alignment Length:154 Identity:34/154 - (22%)
Similarity:66/154 - (42%) Gaps:28/154 - (18%)


- Green bases have known domain annotations that are detailed below.


Human    25 VALITGITGQDGSYLAEFLLEKGYEVHGIVRRSSSFNTGRIEHLYKNPQAHIEGNM-KLHYGDLT 88
            :|...|...|....|.|.:.::.::...||:....|:.  .||       |:...| |:|.|.:.
  Fly    75 MAFTKGYDDQLDELLNEAVFDEDHDEMVIVKDIEMFSL--CEH-------HLVPFMGKVHIGYIP 130

Human    89 DS-----TCLVKIINEVKPTEIYNLGAQSHVKISFDLAEYTADVDGV---GTLRLLDAVKTCGLI 145
            :.     :.|.:|:      |:::...|...:::..:|  ||.|..|   |...:::|...|.::
  Fly   131 NKKVLGLSKLARIV------EMFSRRLQVQERLTKQIA--TAMVQAVQPSGVAVVIEASHMCMVM 187

Human   146 NSVKFYQAS--TSELYGKVQEIPQ 167
            ..|:...||  ||.:.|..::.|:
  Fly   188 RGVQKINASTTTSCMLGVFRDDPK 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
STK3XP_016869245.1 STKc_MST1_2 108..363 CDD:132943 16/65 (25%)
Dsor1NP_511098.1 PKc_MEK 85..382 CDD:132946 31/144 (22%)

Return to query results.
Submit another query.