DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NEK4 and SSK22

DIOPT Version :9

Sequence 1:XP_016862574.1 Gene:NEK4 / 6787 HGNCID:11399 Length:870 Species:Homo sapiens
Sequence 2:NP_009998.2 Gene:SSK22 / 850436 SGDID:S000000669 Length:1331 Species:Saccharomyces cerevisiae


Alignment Length:285 Identity:81/285 - (28%)
Similarity:139/285 - (48%) Gaps:35/285 - (12%)


- Green bases have known domain annotations that are detailed below.


Human    12 VGKGSYGEVTLVKHRRDGKQYVIKKLNLRNASSRER--RAAEQEAQLLSQLKHPNIVTYKESWEG 74
            :|.|::|:|....:..:|:...:|::.:.:.::.::  ...::|..:|..|.|||||.| ...|.
Yeast  1040 IGGGTFGQVYSAINLENGEILAVKEIKIHDTTTMKKIFPLIKEEMTVLEMLNHPNIVQY-YGVEV 1103

Human    75 GDGLLYIVMGFCEGGDLYRKLKEQKGQLLPENQVVEWFVQIAMALQYLHEKHILHRDLKTQNVFL 139
            ....:.|.|.:||||.|...|  ..|::..|.....:..::...|.|||:..::|||:|.:|:.|
Yeast  1104 HRDKVNIFMEYCEGGSLASLL--DHGRIEDEMVTQVYTFELLEGLAYLHQSGVVHRDIKPENILL 1166

Human   140 TRTNIIKVGDLGIARVLEN----------------HCDMASTLIGTPYYMSPELFSNKPYNYK-- 186
            ....|||..|.|.||.:..                .....:.::|||.||:||..|......|  
Yeast  1167 DFNGIIKYVDFGTARTVVGSRTRTVRNAAVQDFGVETKSLNEMMGTPMYMAPETISGSAVKGKLG 1231

Human   187 -SDVWALGCCVYEMATLKHAFNAKDMN-SLVYRIIEGKLPPMP-RDYSPELAELIRTMLSKRPEE 248
             .|||||||.|.||||.:..::..|.. :::|.:..|::|.:| ||   |:....|..|.:...:
Yeast  1232 ADDVWALGCVVLEMATGRRPWSNLDNEWAIMYHVAAGRIPQLPNRD---EMTAAGRAFLERCLVQ 1293

Human   249 RPSVRS----ILRQPYI--KRQISF 267
            .|::|:    :|..|::  .|:|:|
Yeast  1294 DPTMRATAVELLIDPWMIQIREIAF 1318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NEK4XP_016862574.1 None
SSK22NP_009998.2 STKc_MEKK4 1033..1309 CDD:270796 77/274 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.