DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NEK4 and byr1

DIOPT Version :9

Sequence 1:XP_016862574.1 Gene:NEK4 / 6787 HGNCID:11399 Length:870 Species:Homo sapiens
Sequence 2:NP_593026.1 Gene:byr1 / 2542137 PomBaseID:SPAC1D4.13 Length:340 Species:Schizosaccharomyces pombe


Alignment Length:264 Identity:76/264 - (28%)
Similarity:135/264 - (51%) Gaps:15/264 - (5%)


- Green bases have known domain annotations that are detailed below.


Human     9 LRVVGKGSYGEVTLVKHRRDGKQYVIKKLNLRNASSRERRAAEQEAQLLSQLKHPNIVTYKESWE 73
            :|.:|:|:.|.|:|||||   ..::.:|.....:.|:.::...:|..:|...:.|.||.:..:::
pombe    69 VRHLGEGNGGAVSLVKHR---NIFMARKTVYVGSDSKLQKQILRELGVLHHCRSPYIVGFYGAFQ 130

Human    74 GGDGLLYIVMGFCEGGDLYRKLKEQKGQLLPENQVVEWFVQIAMALQYLHE-KHILHRDLKTQNV 137
            ..:. :.:.|.:.:.|.|...|:|  |..:|.:.:.:....:...|.||:. .||:|||||..||
pombe   131 YKNN-ISLCMEYMDCGSLDAILRE--GGPIPLDILGKIINSMVKGLIYLYNVLHIIHRDLKPSNV 192

Human   138 FLTRTNIIKVGDLGIARVLENHCDMASTLIGTPYYMSPELFSNKPYNYKSDVWALGCCVYEMAT- 201
            .:.....||:.|.|::..|.|  .:|.|.:||..|||||......|..|||:|:||..:.|:|| 
pombe   193 VVNSRGEIKLCDFGVSGELVN--SVAQTFVGTSTYMSPERIRGGKYTVKSDIWSLGISIIELATQ 255

Human   202 -LKHAFNAKD----MNSLVYRIIEGKLPPMPRDYSPELAELIRTMLSKRPEERPSVRSILRQPYI 261
             |..:|:..|    :..|::.|::.:.|.:|..:..:|...:...|.|.|..|.|.:.:...||.
pombe   256 ELPWSFSNIDDSIGILDLLHCIVQEEPPRLPSSFPEDLRLFVDACLHKDPTLRASPQQLCAMPYF 320

Human   262 KRQI 265
            ::.:
pombe   321 QQAL 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NEK4XP_016862574.1 None
byr1NP_593026.1 PKc_Byr1_like 60..334 CDD:270792 76/264 (29%)
Pkinase 66..320 CDD:278497 75/258 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.