DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment macroh2a1 and His2A:CG33832

DIOPT Version :10

Sequence 1:NP_001035451.1 Gene:macroh2a1 / 678613 ZFINID:ZDB-GENE-060421-4796 Length:357 Species:Danio rerio
Sequence 2:NP_001027331.1 Gene:His2A:CG33832 / 3772632 FlyBaseID:FBgn0053832 Length:124 Species:Drosophila melanogaster


Alignment Length:123 Identity:78/123 - (63%)
Similarity:91/123 - (73%) Gaps:2/123 - (1%)


- Green bases have known domain annotations that are detailed below.


Zfish     1 MSSR--GGKKKVSRGSRSARAGVIFPVGRMLRFFRRGLPKYRISVGAPVYMAAVLEYLTAEILEL 63
            ||.|  |||.|....|||.|||:.|||||:.|..|:|....|:..|||||:|||:|||.||:|||
  Fly     1 MSGRGKGGKVKGKAKSRSNRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEVLEL 65

Zfish    64 AGNAARDNKKGRVTPRHILLAIANDEELHQLLRGVTISAGGVLPNIHPELLAKKRESR 121
            ||||||||||.|:.|||:.|||.|||||::||.||||:.|||||||...||.||.|.:
  Fly    66 AGNAARDNKKTRIIPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPKKTEKK 123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
macroh2a1NP_001035451.1 H2A 14..119 CDD:197711 70/104 (67%)
Macro_H2A-like 166..353 CDD:394875
His2A:CG33832NP_001027331.1 PTZ00017 16..124 CDD:185399 71/108 (66%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.