DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ELOVL4 and sit

DIOPT Version :9

Sequence 1:NP_073563.1 Gene:ELOVL4 / 6785 HGNCID:14415 Length:314 Species:Homo sapiens
Sequence 2:NP_651063.1 Gene:sit / 42658 FlyBaseID:FBgn0038986 Length:295 Species:Drosophila melanogaster


Alignment Length:296 Identity:125/296 - (42%)
Similarity:187/296 - (63%) Gaps:11/296 - (3%)


- Green bases have known domain annotations that are detailed below.


Human    18 ALNDT-VEFYRWTWS-IADKRVENWPLMQSPWPTLSISTLYLLFV--WLGPKWMKDREPFQMRLV 78
            |:|.| |:::.:.:: :||.|..:|.|::||.|.|.|...||.||  | |||:||||:||::...
  Fly     3 AVNATQVDYWNFLFTDLADPRTNDWFLIKSPLPLLGILAFYLFFVLSW-GPKFMKDRKPFKLERT 66

Human    79 LIIYNFGMVLLNLF-IFRELFMGSYNAGYSYICQSVDYSNNVHEVRIAAALWWYFVSKGVEYLDT 142
            |::|||..|.|::: ::..:.:..|   ||:.||.||:|......|.|..::.|:::|..|.|||
  Fly    67 LLVYNFFQVALSVWMVYEGVVIWQY---YSWRCQPVDWSRTPKAYREARVVYVYYLAKITELLDT 128

Human   143 VFFILRKKNNQVSFLHVYHHCTMFTLWWIGIKWVAGGQAFFGAQLNSFIHVIMYSYYGLTAFGPW 207
            :||:|||.:.||:|||||||..|..:.|...|:..||...|...:|||:|:||||||.|:||||.
  Fly   129 IFFVLRKNDRQVTFLHVYHHTVMPMISWGTSKYYPGGHGTFIGWINSFVHIIMYSYYFLSAFGPQ 193

Human   208 IQKYLWWKRYLTMLQLIQFHVTIGHTALSLYTDCPFPKWMHWALIAYAISFIFLFLNFYIRTYKE 272
            :|||||||:|:|.||:|||.....|....|||||.:|:|.....:..|:.|.|||.:||.::||:
  Fly   194 MQKYLWWKKYITNLQMIQFCCAFIHQTQLLYTDCGYPRWSVCFTLPNAVFFYFLFNDFYQKSYKK 258

Human   273 PKKPKAGKTAMNGISAN-GVSKSEKQLMIENGKKQK 307
             |:..|.:.|::..:.| |.:|...:.:....:|||
  Fly   259 -KQAAAKEKALSADNNNDGCAKDLNKAIQLQQEKQK 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ELOVL4NP_073563.1 ELO 41..278 CDD:279492 109/239 (46%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 275..314 8/34 (24%)
Di-lysine motif. /evidence=ECO:0000255|HAMAP-Rule:MF_03204 310..314
sitNP_651063.1 ELO 28..252 CDD:279492 104/227 (46%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H41488
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2880
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.770

Return to query results.
Submit another query.