DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ELOVL4 and eloF

DIOPT Version :9

Sequence 1:NP_073563.1 Gene:ELOVL4 / 6785 HGNCID:14415 Length:314 Species:Homo sapiens
Sequence 2:NP_649956.1 Gene:eloF / 41211 FlyBaseID:FBgn0037762 Length:257 Species:Drosophila melanogaster


Alignment Length:257 Identity:88/257 - (34%)
Similarity:137/257 - (53%) Gaps:34/257 - (13%)


- Green bases have known domain annotations that are detailed below.


Human    41 PLMQSPWPTLSISTLYLLFVW-LGPKWMKDREPFQMRLVLIIYNFGMVLLN----------LFIF 94
            |::.:||.|:.....|||||. ||||.|:.|:||.:..|:.|||...:|.|          ||:.
  Fly    11 PVVSNPWITMGTLIGYLLFVLKLGPKIMEHRKPFHLNGVIRIYNIFQILYNGLILVLGVHFLFVL 75

Human    95 RELFMGSYNAGYSYIC---QSVDYSNNVHEVRIAAALWWYFVSKGVEYLDTVFFILRKKNNQVSF 156
            :         .|...|   ..:|:.....| |:...|  |.|:|.|:.::|:||:||||:.|:||
  Fly    76 K---------AYQISCIVSLPMDHKYKDRE-RLICTL--YLVNKFVDLVETIFFVLRKKDRQISF 128

Human   157 LHVYHHCTMFTLWWIGIKWVA----GGQAFFGAQLNSFIHVIMYSYYGLTAFGPWIQKYLWWKRY 217
            |||:||   |.:.:.|..:..    ||.||....||:.:|||||:||.|::....:|:.||||:|
  Fly   129 LHVFHH---FAMAFFGYLYYCFHGYGGVAFPQCLLNTAVHVIMYAYYYLSSISKEVQRSLWWKKY 190

Human   218 LTMLQLIQFHVTIGHTALSL-YTDCPFPKWMHWALIAYAISFIFLFLNFYIRTYKEPKKPKA 278
            :|:.||:||.:.:.|..::| ..:|...:.:.:...:.:..|..:|..||...|.:|.|..|
  Fly   191 ITIAQLVQFAIILLHCTITLAQPNCAVNRPLTYGCGSLSAFFAVIFSQFYYHNYIKPGKKSA 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ELOVL4NP_073563.1 ELO 41..278 CDD:279492 87/255 (34%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 275..314 2/4 (50%)
Di-lysine motif. /evidence=ECO:0000255|HAMAP-Rule:MF_03204 310..314
eloFNP_649956.1 ELO 11..252 CDD:279492 87/255 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R389
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.