DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ELOVL4 and ELOVL

DIOPT Version :9

Sequence 1:NP_073563.1 Gene:ELOVL4 / 6785 HGNCID:14415 Length:314 Species:Homo sapiens
Sequence 2:NP_649754.1 Gene:ELOVL / 40943 FlyBaseID:FBgn0037534 Length:329 Species:Drosophila melanogaster


Alignment Length:287 Identity:125/287 - (43%)
Similarity:181/287 - (63%) Gaps:14/287 - (4%)


- Green bases have known domain annotations that are detailed below.


Human    33 ADKRVENWPLMQSPWPTLSISTLYLLFV-WLGPKWMKDREPFQMRLVLIIYNFGMVLLNLFIFRE 96
            :|.|..::|||.||:||::||..|...| .||||.|::|:||::|.|||:||...|:.:.::|.|
  Fly    19 SDPRTRDYPLMSSPFPTIAISLTYAYIVKVLGPKLMENRKPFELRKVLIVYNAAQVIFSAWLFYE 83

Human    97 LFMGSYNAGYSYICQSVDYSNNVHEVRIAAALWWYFVSKGVEYLDTVFFILRKKNNQVSFLHVYH 161
            ..:|.:..||:..|:.|:||.:...:|.|...|||:.||..|:.||.||::||:.:|||.|||.|
  Fly    84 SCIGGWLNGYNLRCEPVNYSYSPKAIRTAEGCWWYYFSKFTEFFDTFFFVMRKRYDQVSTLHVIH 148

Human   162 HCTM-FTLWWIGIKWVAGGQAFFGAQLNSFIHVIMYSYYGLTAFGPWIQKYLWWKRYLTMLQLIQ 225
            |..| .::|| |:|:..||.:.|...||:|:|:.||:||.|.|.||.:|||||||:|||::|:||
  Fly   149 HGIMPVSVWW-GVKFTPGGHSTFFGFLNTFVHIFMYAYYMLAAMGPKVQKYLWWKKYLTVMQMIQ 212

Human   226 FHVTIGHT-ALSLYTDCPFPKWMHWALIAYAISFIFLFLNFYIRTY-KEPKKPKAGKTAMNGISA 288
            |.:.:.|: .|....||.:|....:.:.|:|:.|.|||.|||.|.| |...|.||...| || .|
  Fly   213 FVLVMVHSFQLFFKNDCNYPIGFAYFIGAHAVMFYFLFSNFYKRAYVKRDGKDKASVKA-NG-HA 275

Human   289 NGVSKSEKQLMIENG--KKQKNGKAKG 313
            ||..|:     :::|  ....||:|.|
  Fly   276 NGHVKA-----LKDGDVAPTSNGQANG 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ELOVL4NP_073563.1 ELO 41..278 CDD:279492 109/240 (45%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 275..314 15/41 (37%)
Di-lysine motif. /evidence=ECO:0000255|HAMAP-Rule:MF_03204 310..314 2/4 (50%)
ELOVLNP_649754.1 ELO 27..266 CDD:366492 109/239 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100254
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R389
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.750

Return to query results.
Submit another query.