DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ELOVL4 and CG31523

DIOPT Version :9

Sequence 1:NP_073563.1 Gene:ELOVL4 / 6785 HGNCID:14415 Length:314 Species:Homo sapiens
Sequence 2:NP_001262255.1 Gene:CG31523 / 326148 FlyBaseID:FBgn0051523 Length:354 Species:Drosophila melanogaster


Alignment Length:320 Identity:125/320 - (39%)
Similarity:176/320 - (55%) Gaps:34/320 - (10%)


- Green bases have known domain annotations that are detailed below.


Human    24 EFYRWTWSI----ADKRVENWPLMQSPWPTLSISTLYLLF-VWLGPKWMKDREPFQMRLVLIIYN 83
            |..:|...:    :|.||.::.|:.||.|||.:...|..| ..|||:.|..|:|.::|.||::||
  Fly     7 EAQKWYRDLMDNKSDPRVNDFFLLSSPLPTLCMCIFYAYFSKSLGPRLMAKRKPMELRSVLVVYN 71

Human    84 FGMVLLNLFIFRELFMGSYNAGYSYICQSVDYSNNVHEVRIAAALWWYFVSKGVEYLDTVFFILR 148
            ....:.:.:||.|..|..:...||..||.||||.....:|:....|||::||..|:.||:|||||
  Fly    72 AIQTIFSAWIFYEYLMSGWWGHYSLKCQPVDYSTTGLAMRMVNICWWYYISKFTEFFDTLFFILR 136

Human   149 KKNNQVSFLHVYHH-CTMFTLWWIGIKWVAGGQAFFGAQLNSFIHVIMYSYYGLTAFGPWIQKYL 212
            |||..||.|||.|| |..|:: |:|:|:..||.:.|.|.||||:|::||.||.:.|.||..|||:
  Fly   137 KKNEHVSTLHVIHHGCMPFSV-WMGLKFAPGGHSTFFALLNSFVHIVMYFYYMIAAMGPKYQKYI 200

Human   213 WWKRYLTMLQLIQFHVTIGHTALSLYTDCPFPK-WMHWALIAYAISFIFLFLNFYIRTY-----K 271
            |||:|||..|::||.....|....|:.:|.:|| :|.| :..:.:.|:|||.:||...|     :
  Fly   201 WWKKYLTTFQMVQFVAIFTHQFQLLFRECDYPKGFMVW-IGLHGVMFLFLFSDFYKAKYLNAARR 264

Human   272 EPKKPKAGKTAMNGISANGVSK--SEKQLMIENG-----------------KKQKNGKAK 312
            ..:..||...| ||.::||.||  .|...:|.||                 |.|.||..|
  Fly   265 RRQAVKANGYA-NGSASNGHSKHLGEGDALIANGCNTGACMPVMEDEYVKSKGQSNGAYK 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ELOVL4NP_073563.1 ELO 41..278 CDD:279492 102/244 (42%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 275..314 18/57 (32%)
Di-lysine motif. /evidence=ECO:0000255|HAMAP-Rule:MF_03204 310..314 1/3 (33%)
CG31523NP_001262255.1 ELO 28..265 CDD:279492 102/238 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100254
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.720

Return to query results.
Submit another query.