DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atp1b4 and CG33310

DIOPT Version :9

Sequence 1:NP_598451.1 Gene:Atp1b4 / 67821 MGIID:1915071 Length:356 Species:Mus musculus
Sequence 2:NP_995718.2 Gene:CG33310 / 2768910 FlyBaseID:FBgn0053310 Length:876 Species:Drosophila melanogaster


Alignment Length:320 Identity:65/320 - (20%)
Similarity:121/320 - (37%) Gaps:89/320 - (27%)


- Green bases have known domain annotations that are detailed below.


Mouse    63 EEEEREEEEG-QGQSTGSAWWRKL---QIVNEYLWDPEKRMSLARTGQSRSLILVIYFFFYASLA 123
            :|:.|...:| :....|...||:|   :|..:|        .|.|  .|..|..:::...|    
  Fly   564 KEDRRTYYKGCEYHFPGRTEWRRLFFNKIHGKY--------KLRR--PSHWLYTLVFSVLY---- 614

Mouse   124 AVITLFIYMLFLAISPYMPTFTEQVKPPGVMIRPFAHSLNFNFNVSEPETWQRYVISLNGFLQGY 188
               .||:.:..:|...::.....:..|...|.:||     .:|....|.|..: .:|.:.  :..
  Fly   615 ---ILFVIIFSMAWFDFIKDDASRKVPMIKMAQPF-----ISFTPIGPRTNPK-AVSFDP--RNS 668

Mouse   189 NDSLQEEMNIDCPPGRYFIQDGDEDEDKKACQFKRSFLKNCSGLEDPTFGYSTGQPCILLKMNRI 253
            .:.:::...|.....:|    ||...:.:        ...|:..|  .|||.:|:||:.||:|||
  Fly   669 TEVMEKYAGIMALLEKY----GDYGHNPR--------FGTCTANE--KFGYPSGEPCVFLKVNRI 719

Mouse   254 VGFRPE----FGDPVK-----------------------------VSCKVQKGDENDIRSINYYP 285
            :||:.|    ..:.||                             ::|:..| |:|.:  |.::|
  Fly   720 IGFKTEPYINSDELVKAKIDEVEFTALKRLLENTTTEEGHLNRTWITCRSDK-DKNVL--IEFHP 781

Mouse   286 ESA--------SFDLRYYPYYGKLTHV--NYTSPLVAMHFTDVVKNQAVPVQCQLKGKGI 335
            |.|        ...:.|....||.:..  |..:.:||:...::..|:.|.:.|::..:.|
  Fly   782 EPAIRTEYTDIEEKIEYIANEGKKSFFGPNDVNRIVALKIKNLKANERVHINCKMWAQNI 841

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atp1b4NP_598451.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 26..78 3/15 (20%)
Na_K-ATPase 84..349 CDD:278704 59/298 (20%)
CG33310NP_995718.2 Na_K-ATPase <703..847 CDD:298651 34/142 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D422722at33208
OrthoFinder 1 1.000 - - FOG0000357
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11523
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.110

Return to query results.
Submit another query.