DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kirrel3 and CG34353

DIOPT Version :9

Sequence 1:XP_006510620.1 Gene:Kirrel3 / 67703 MGIID:1914953 Length:803 Species:Mus musculus
Sequence 2:NP_001287571.1 Gene:CG34353 / 5740590 FlyBaseID:FBgn0085382 Length:581 Species:Drosophila melanogaster


Alignment Length:569 Identity:98/569 - (17%)
Similarity:166/569 - (29%) Gaps:218/569 - (38%)


- Green bases have known domain annotations that are detailed below.


Mouse    34 MAKDKFRRMNEGQVYSFSQQPQDQVVVSGQPVTLLCAIPEYDGFVLWIKDGLALGVGRDLSSYPQ 98
            |.|::...::..:.:.|         ::|:.:.|.|.:...|.:|:..|.|:|:.....:...|.
  Fly    81 MTKNEPMFISRSETFKF---------ITGETIVLPCEVANTDTYVVAWKRGIAILTAGSVKVTPD 136

Mouse    99 YLVVGNHLSGEHHLKILRAELQDDAVYECQAIQAAIRSRPARLTVLVPPDDPIILGGPVISLRAG 163
            ..|   .|....:|:|..|...|...|.||......|.....:.:||||....|..|..:.::.|
  Fly   137 PRV---RLVNGFNLQIRDALPTDAGDYICQIATMDPREITHTVEILVPPRIHHISTGGHLQVKKG 198

Mouse   164 DPLNLTCHADNAKPAASIIWLRKGEVINGATYSKTLLRDGKRESIVSTLFISPGDVENGQSIVCR 228
            ..:.:.|.| ...|..::.|.||..:          |.:|:.:.....|.|...|...|...:|.
  Fly   199 SSVRIECSA-TGNPMPNVTWSRKNNI----------LPNGEEKLHSHVLSIENVDRHKGGVYICT 252

Mouse   229 ATNKAIPGGKETSVTIDIQHPPLVNLSVEPQPVLEDNIVTFHCSAKANPAVTQYRWAKRGHIIKE 293
            |.|:.                                                            
  Fly   253 ANNRV------------------------------------------------------------ 257

Mouse   294 ASGELYRTTVDYTYFSEPVSCEVTNALGSTNLSRTVDVYFGPRMTSEPQSLLVDLGSDAVFSCAW 358
                           .:|.|.:|           .:.|.|.|.::.|...:....|.:|...|..
  Fly   258 ---------------GQPASSQV-----------VLHVLFSPEISVERPVVFSGEGHEATLVCIV 296

Mouse   359 IGNPSLTIVWMK---------------RGSGVVLSNEKTLTLKSVRQEDAGKYVCRAVVPRVGAG 408
            .|.....::|.|               |||      ..||.::.|..:|.|.|.|   |.....|
  Fly   297 HGETQPEVIWFKDTMQLDTTERHIMETRGS------RHTLIIRKVHPQDFGNYSC---VAENQLG 352

Mouse   409 EREVTLTVNGPPIISSTQTQHALHGEKGQIKCFIRSTPP----PDRIAWSW---KENVLESGTSG 466
            :...||.::|.|.::                  :.::||    .||...||   ..:.:|     
  Fly   353 KARKTLQLSGKPNVA------------------VFNSPPISQYKDRYNISWAVDSHSPIE----- 394

Mouse   467 RYTVETVNTEEG--VISTLTISNIVRADFQTIYNCTAWNSFGSDTEIIRLKEQGSEMKSGAGLEA 529
            .|.:......:|  |:.                     |:..|.:....:....|:| .|:||.|
  Fly   395 EYKLSFRKLPQGHEVVG---------------------NAIDSSSSSSSMSSSSSQM-YGSGLHA 437

Mouse   530 ESVPMAVIIGVAVGAGVAFLVLMATIVAFCCARSQRSTGGRPGISGRGT 578
            .          .:|:.:                     ||..|:||.|:
  Fly   438 H----------RIGSNM---------------------GGLSGLSGSGS 455

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Kirrel3XP_006510620.1 IG_like 54..143 CDD:214653 19/88 (22%)
Ig strand A' 56..60 CDD:409353 0/3 (0%)
Ig strand B 64..71 CDD:409353 2/6 (33%)
Ig strand C 78..82 CDD:409353 1/3 (33%)
Ig strand C' 84..87 CDD:409353 1/2 (50%)
Ig strand D 97..101 CDD:409353 1/3 (33%)
Ig strand E 104..116 CDD:409353 3/11 (27%)
Ig strand G 132..143 CDD:409353 1/10 (10%)
IgI_2_KIRREL3-like 149..246 CDD:409416 18/96 (19%)
Ig strand B 166..170 CDD:409416 0/3 (0%)
Ig strand C 180..184 CDD:409416 0/3 (0%)
Ig strand E 210..214 CDD:409416 1/3 (33%)
Ig strand F 224..229 CDD:409416 1/4 (25%)
Ig strand G 239..242 CDD:409416 0/2 (0%)
Ig <267..334 CDD:416386 4/66 (6%)
Ig strand B 267..274 CDD:409353 0/6 (0%)
Ig strand C 279..286 CDD:409353 0/6 (0%)
Ig strand C' 288..291 CDD:409353 0/2 (0%)
Ig strand D 298..302 CDD:409353 0/3 (0%)
Ig strand E 304..310 CDD:409353 0/5 (0%)
Ig strand G 321..334 CDD:409353 1/12 (8%)
Ig 335..416 CDD:416386 22/95 (23%)
Ig strand A' 343..347 CDD:409353 0/3 (0%)
Ig strand B 350..360 CDD:409353 2/9 (22%)
Ig strand C 365..371 CDD:409353 2/20 (10%)
Ig strand E 381..387 CDD:409353 2/5 (40%)
IgI_5_KIRREL3 418..515 CDD:409479 14/105 (13%)
Ig strand B 436..440 CDD:409479 0/3 (0%)
Ig strand C 450..454 CDD:409479 1/3 (33%)
Ig strand E 481..485 CDD:409479 0/3 (0%)
Ig strand F 496..501 CDD:409479 0/4 (0%)
Ig strand G 509..512 CDD:409479 0/2 (0%)
CG34353NP_001287571.1 IG_like 100..180 CDD:214653 19/82 (23%)
Ig 103..177 CDD:143165 18/76 (24%)
IG_like 191..269 CDD:214653 19/174 (11%)
IGc2 198..258 CDD:197706 16/145 (11%)
I-set 273..360 CDD:254352 22/95 (23%)
Ig 290..359 CDD:143165 18/77 (23%)
FN3 <466..524 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.