DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kirrel3 and sns

DIOPT Version :9

Sequence 1:XP_006510620.1 Gene:Kirrel3 / 67703 MGIID:1914953 Length:803 Species:Mus musculus
Sequence 2:NP_001036532.1 Gene:sns / 44097 FlyBaseID:FBgn0024189 Length:1542 Species:Drosophila melanogaster


Alignment Length:834 Identity:183/834 - (21%)
Similarity:288/834 - (34%) Gaps:235/834 - (28%)


- Green bases have known domain annotations that are detailed below.


Mouse    43 NEGQVYSFSQQPQDQVVVSGQPVTLLCAIPEYDGFVLWIKDGLALGVGRDLSSYPQYLVVGNHLS 107
            :..|...|...|.|..|:.|....:.|.:....|.|.|.|||.|||....:..:|:|.|:|:...
  Fly    67 SHAQQQKFRTTPHDLQVLEGAEAMMRCEVANVAGAVQWTKDGFALGFSAVIPGFPRYSVLGDRKQ 131

Mouse   108 GEHHLKILRAELQDDAVYECQA----IQAAIRSRPARLTVLVPPDDPIILG---GPVISLRAGDP 165
            |.::|:|..|.:.|||.|:||.    :.:|||:. |:|||:.||....|.|   ...:.:|....
  Fly   132 GIYNLRISNASINDDADYQCQVGPARLNSAIRAN-AKLTVISPPASIEIKGYSHNSKVEVRENQD 195

Mouse   166 LNLTCHADNAKPAASIIWLRKGEVINGATYSKTLLRD------GKRESIVSTLFISPGDVENGQS 224
            |.|.|...||||||.|:|.| |.|    .|......|      .||.:..|:|.:.||..::...
  Fly   196 LQLKCIVANAKPAAQIVWYR-GNV----EYKPEKREDTVEESTAKRFTTTSSLKLKPGPDDDYTE 255

Mouse   225 IVCRATNKAIPGGKETSVTIDIQ-----HPPLVNLSVEPQPVLEDNIVTFHCSAKANPAVTQYRW 284
            ..|:|.:||:........|:.:.     .||.:......:.:.....|...|.::......|..|
  Fly   256 YTCQARHKALSPDMPMRATVQLSVLYPPGPPYIEGYSAGETLRRGQTVELMCRSRGGNPPAQLIW 320

Mouse   285 AKRGHIIKEA---SGELYRTTVDYTYFSEP------VSCEVTNALGSTNLSRTVD--VYFGPRMT 338
            .|.|..|:.|   ||.|....  ||:.:|.      ..||.:|.:....|...|:  |.|.|...
  Fly   321 YKNGSQIRMAYRTSGRLSENI--YTFTAEAGDNKARFRCEASNVMSQNPLKAEVELSVLFAPTHV 383

Mouse   339 SEPQSLLVDLGSDAVFSCAWI-GNPSLTIVWMKRGSGVVLSNEKTLTLKSVRQEDAGKYVCRAVV 402
            :........:|.....:|... .||...|.||..|..|     :..|.|::...:.|......:.
  Fly   384 TVMGPTEARVGDIVPLTCTTAPSNPPAEIKWMVGGRQV-----RNATSKTIVSPEGGWTTTSNIT 443

Mouse   403 PRVGAGEREVTLTVNGPPI-----ISSTQTQHALHGEKGQIKCFIRSTPPPDRIAWSWKENVLES 462
            ..|...:|.:.:..:|..:     :.||.|.:.|:            .|.|..|:...:..::.:
  Fly   444 AVVEPNKRSLVVICHGLNMQLTENVVSTHTINVLY------------PPAPPLISGYMEGQIIPA 496

Mouse   463 GTSGRYTVETVNTEEGVISTLT-------ISNIVRA----------------DFQTIYNCTAWNS 504
            |:..:  :..|::....::|||       |::::||                |.|..|.|.|.||
  Fly   497 GSVQK--LLCVSSGGNPLATLTWYKNDKRINSVIRAADKSVSAEITILANVSDNQAQYRCEASNS 559

Mouse   505 ------FGSDT-------EIIRLKEQGSEMKSGAGLEAESVPMAVIIGVAVGAGVAFLVLMATIV 556
                  |.|.|       |.::::.:..|::.|                          :.|||:
  Fly   560 ATEIPLFQSTTLSVHFAPETVKIRIEPEELRPG--------------------------MEATII 598

Mouse   557 AFCCARSQR-----------------STGGRPGISGRGTEKKARLRLPRRANLKGVV-------- 596
              |.:.|..                 :...:||:.| ||......|:.....:.|.|        
  Fly   599 --CDSSSSNPPAKLSWWKDGIPIEGINNTSKPGLWG-GTVSTLEFRVNVTQEMNGQVYTCQSANE 660

Mouse   597 ----SAKNDIRVEIVHK-----EPSS---GREAE---------------------DHTTIKQ--- 625
                ||...:.::::::     .|||   |.|.|                     |.|||.|   
  Fly   661 ALQRSAHEAVSLDVLYRPKFVPPPSSTAVGVEGESLQVSLQTRANPTPVTYKWTKDGTTIPQDGD 725

Mouse   626 --LMMDRGEFQQDSVLKQLEVLKEEEKEFQNLKDPTNGYYSVN------------TFKEHHSTPT 676
              :..|.|..                 .|..|.....|.||.:            |....:.|..
  Fly   726 HRIFADGGSL-----------------NFTRLHRDDAGIYSCSASNSQGGATLNITVVVEYGTTI 773

Mouse   677 ISLS-------------SCQPDLRPTGKQRVP---TGMSFTNIYSTLSGQGRLY 714
            .|:|             ||..:.:|..::.|.   .|...|...||....|..|
  Fly   774 KSVSENIVVNPGEDAMLSCTVEGKPLTEEHVKWERVGYDMTVKTSTTFANGTSY 827

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Kirrel3XP_006510620.1 IG_like 54..143 CDD:214653 33/92 (36%)
Ig strand A' 56..60 CDD:409353 1/3 (33%)
Ig strand B 64..71 CDD:409353 1/6 (17%)
Ig strand C 78..82 CDD:409353 2/3 (67%)
Ig strand C' 84..87 CDD:409353 1/2 (50%)
Ig strand D 97..101 CDD:409353 2/3 (67%)
Ig strand E 104..116 CDD:409353 3/11 (27%)
Ig strand G 132..143 CDD:409353 5/10 (50%)
IgI_2_KIRREL3-like 149..246 CDD:409416 30/105 (29%)
Ig strand B 166..170 CDD:409416 2/3 (67%)
Ig strand C 180..184 CDD:409416 1/3 (33%)
Ig strand E 210..214 CDD:409416 2/3 (67%)
Ig strand F 224..229 CDD:409416 1/4 (25%)
Ig strand G 239..242 CDD:409416 0/2 (0%)
Ig <267..334 CDD:416386 20/77 (26%)
Ig strand B 267..274 CDD:409353 2/6 (33%)
Ig strand C 279..286 CDD:409353 2/6 (33%)
Ig strand C' 288..291 CDD:409353 1/2 (50%)
Ig strand D 298..302 CDD:409353 1/3 (33%)
Ig strand E 304..310 CDD:409353 2/5 (40%)
Ig strand G 321..334 CDD:409353 3/14 (21%)
Ig 335..416 CDD:416386 15/81 (19%)
Ig strand A' 343..347 CDD:409353 0/3 (0%)
Ig strand B 350..360 CDD:409353 1/10 (10%)
Ig strand C 365..371 CDD:409353 3/5 (60%)
Ig strand E 381..387 CDD:409353 1/5 (20%)
IgI_5_KIRREL3 418..515 CDD:409479 27/137 (20%)
Ig strand B 436..440 CDD:409479 0/3 (0%)
Ig strand C 450..454 CDD:409479 1/3 (33%)
Ig strand E 481..485 CDD:409479 3/10 (30%)
Ig strand F 496..501 CDD:409479 2/4 (50%)
Ig strand G 509..512 CDD:409479 2/9 (22%)
snsNP_001036532.1 I-set 73..170 CDD:254352 34/97 (35%)
Ig 76..155 CDD:299845 28/78 (36%)
IG_like 186..279 CDD:214653 28/97 (29%)
Ig 197..279 CDD:299845 26/86 (30%)
IG_like 296..376 CDD:214653 19/81 (23%)
Ig 300..361 CDD:299845 16/62 (26%)
Ig 380..454 CDD:299845 15/78 (19%)
IG_like 490..573 CDD:214653 18/84 (21%)
Ig 501..560 CDD:299845 13/60 (22%)
Ig 584..666 CDD:299845 15/110 (14%)
IG_like 585..666 CDD:214653 15/109 (14%)
I-set 678..767 CDD:254352 19/105 (18%)
IGc2 692..757 CDD:197706 14/81 (17%)
Ig 788..849 CDD:143165 10/40 (25%)
Ig 885..960 CDD:143165
FN3 967..1051 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D141865at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.