DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kirrel3 and dpr16

DIOPT Version :9

Sequence 1:XP_006510620.1 Gene:Kirrel3 / 67703 MGIID:1914953 Length:803 Species:Mus musculus
Sequence 2:NP_001287169.1 Gene:dpr16 / 40619 FlyBaseID:FBgn0037295 Length:488 Species:Drosophila melanogaster


Alignment Length:257 Identity:71/257 - (27%)
Similarity:99/257 - (38%) Gaps:54/257 - (21%)


- Green bases have known domain annotations that are detailed below.


Mouse   289 HIIKEASGELYRTTVDYTYFSEPVSCEVTNALGSTNLSRTVDVYFGPRM--TSEPQSLLVDLGSD 351
            |||          .||:|.|..  .....:.|.||.|:..|.   |..:  |:.|.:.|.:..:.
  Fly   239 HII----------AVDHTTFIN--DARFASLLQSTTLTTLVS---GGALSTTATPVAALGNSFAH 288

Mouse   352 AVFSCAWIGNPSLTIVWMKRGSGVVLSNEKTLTLKSVRQEDAGKYVCR-AVVPRVGAGEREVTLT 415
            ||......||.| ::.|             ||.:|.|..||||.|.|: |..|::.|   :|.|.
  Fly   289 AVPGGQERGNSS-SLSW-------------TLQIKYVNLEDAGWYECQLATEPKMSA---KVQLF 336

Mouse   416 VNGP--PIISSTQTQHALHGEKGQIKCFIRST-PPPDRIAW------SWKENVLESGTSGRYTVE 471
            |..|  .:|...| :....|.:.::.|.:|.| ..|..|.|      ...||......||.||..
  Fly   337 VI
TPRTELIGDRQ-RFVKAGSRVELHCIVRGTLEAPKYIFWYRGDQQVTAENEASGAQSGWYTQI 400

Mouse   472 TVN----TE--EGVISTLTISNIVRADFQTIYNCTAWNSFGSDTEIIRLKEQ--GSEMKSGA 525
            ..|    ||  ...|.:|.|. :||......|.|...||..:..::..|..:  .|.:||.|
  Fly   401 DRNIFGSTEHNRNTIGSLVIP-LVRKIHSGNYTCEPENSAAASMQLHVLSGEYSASAIKSTA 461

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Kirrel3XP_006510620.1 IG_like 54..143 CDD:214653
Ig strand A' 56..60 CDD:409353
Ig strand B 64..71 CDD:409353
Ig strand C 78..82 CDD:409353
Ig strand C' 84..87 CDD:409353
Ig strand D 97..101 CDD:409353
Ig strand E 104..116 CDD:409353
Ig strand G 132..143 CDD:409353
IgI_2_KIRREL3-like 149..246 CDD:409416
Ig strand B 166..170 CDD:409416
Ig strand C 180..184 CDD:409416
Ig strand E 210..214 CDD:409416
Ig strand F 224..229 CDD:409416
Ig strand G 239..242 CDD:409416
Ig <267..334 CDD:416386 12/44 (27%)
Ig strand B 267..274 CDD:409353
Ig strand C 279..286 CDD:409353
Ig strand C' 288..291 CDD:409353 1/1 (100%)
Ig strand D 298..302 CDD:409353 0/3 (0%)
Ig strand E 304..310 CDD:409353 3/5 (60%)
Ig strand G 321..334 CDD:409353 4/12 (33%)
Ig 335..416 CDD:416386 24/83 (29%)
Ig strand A' 343..347 CDD:409353 1/3 (33%)
Ig strand B 350..360 CDD:409353 2/9 (22%)
Ig strand C 365..371 CDD:409353 1/5 (20%)
Ig strand E 381..387 CDD:409353 2/5 (40%)
IgI_5_KIRREL3 418..515 CDD:409479 28/111 (25%)
Ig strand B 436..440 CDD:409479 0/3 (0%)
Ig strand C 450..454 CDD:409479 2/9 (22%)
Ig strand E 481..485 CDD:409479 1/3 (33%)
Ig strand F 496..501 CDD:409479 2/4 (50%)
Ig strand G 509..512 CDD:409479 0/2 (0%)
dpr16NP_001287169.1 IG_like 205..337 CDD:214653 37/129 (29%)
Ig <298..338 CDD:299845 18/56 (32%)
IG_like 352..447 CDD:214653 25/95 (26%)
Ig 358..439 CDD:143165 23/81 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.