| Sequence 1: | XP_006510620.1 | Gene: | Kirrel3 / 67703 | MGIID: | 1914953 | Length: | 803 | Species: | Mus musculus |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_477404.1 | Gene: | wrapper / 37555 | FlyBaseID: | FBgn0025878 | Length: | 500 | Species: | Drosophila melanogaster |
| Alignment Length: | 337 | Identity: | 75/337 - (22%) |
|---|---|---|---|
| Similarity: | 122/337 - (36%) | Gaps: | 67/337 - (19%) |
- Green bases have known domain annotations that are detailed below.
|
Mouse 244 IDIQHPPLVNLSVEPQPVLEDNIVTFH---CSAKA--NPAVTQYRWAKRGHIIKEASGELYRTTV 303
Mouse 304 DYTYFSEP----VSCEVTNALGSTNLSRT-VDVYFGPRMTSEPQSLLVDLGSDAVFSCAWIGNPS 363
Mouse 364 LTIVWMKRGSGVVLSNEKT----------------------LTLKSVRQEDAGKYVCRAVVPRVG 406
Mouse 407 AGEREVTLTVNGPPII------SSTQTQHALHGEKG------QIKCFIRSTPPPD---RIAWSWK 456
Mouse 457 E-NVLESGTSGRYTVETVNTEEGVISTLTISNIVRADFQTIYNCTAWNSFG--SDTEIIRLKEQG 518
Mouse 519 SEMKSGAGLEAE 530 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Kirrel3 | XP_006510620.1 | IG_like | 54..143 | CDD:214653 | |
| Ig strand A' | 56..60 | CDD:409353 | |||
| Ig strand B | 64..71 | CDD:409353 | |||
| Ig strand C | 78..82 | CDD:409353 | |||
| Ig strand C' | 84..87 | CDD:409353 | |||
| Ig strand D | 97..101 | CDD:409353 | |||
| Ig strand E | 104..116 | CDD:409353 | |||
| Ig strand G | 132..143 | CDD:409353 | |||
| IgI_2_KIRREL3-like | 149..246 | CDD:409416 | 1/1 (100%) | ||
| Ig strand B | 166..170 | CDD:409416 | |||
| Ig strand C | 180..184 | CDD:409416 | |||
| Ig strand E | 210..214 | CDD:409416 | |||
| Ig strand F | 224..229 | CDD:409416 | |||
| Ig strand G | 239..242 | CDD:409416 | |||
| Ig | <267..334 | CDD:416386 | 14/76 (18%) | ||
| Ig strand B | 267..274 | CDD:409353 | 1/9 (11%) | ||
| Ig strand C | 279..286 | CDD:409353 | 2/6 (33%) | ||
| Ig strand C' | 288..291 | CDD:409353 | 1/2 (50%) | ||
| Ig strand D | 298..302 | CDD:409353 | 1/3 (33%) | ||
| Ig strand E | 304..310 | CDD:409353 | 0/5 (0%) | ||
| Ig strand G | 321..334 | CDD:409353 | 2/13 (15%) | ||
| Ig | 335..416 | CDD:416386 | 26/102 (25%) | ||
| Ig strand A' | 343..347 | CDD:409353 | 0/3 (0%) | ||
| Ig strand B | 350..360 | CDD:409353 | 3/9 (33%) | ||
| Ig strand C | 365..371 | CDD:409353 | 2/5 (40%) | ||
| Ig strand E | 381..387 | CDD:409353 | 2/27 (7%) | ||
| IgI_5_KIRREL3 | 418..515 | CDD:409479 | 22/114 (19%) | ||
| Ig strand B | 436..440 | CDD:409479 | 0/9 (0%) | ||
| Ig strand C | 450..454 | CDD:409479 | 0/3 (0%) | ||
| Ig strand E | 481..485 | CDD:409479 | 1/3 (33%) | ||
| Ig strand F | 496..501 | CDD:409479 | 0/4 (0%) | ||
| Ig strand G | 509..512 | CDD:409479 | 0/2 (0%) | ||
| wrapper | NP_477404.1 | Ig | 41..124 | CDD:299845 | |
| IG_like | 41..118 | CDD:214653 | |||
| IG_like | 145..218 | CDD:214653 | 14/75 (19%) | ||
| Ig | 147..219 | CDD:299845 | 13/74 (18%) | ||
| I-set | 224..323 | CDD:254352 | 24/99 (24%) | ||
| IGc2 | 236..314 | CDD:197706 | 22/78 (28%) | ||
| FN3 | 339..431 | CDD:238020 | 21/102 (21%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||