DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kirrel3 and dpr19

DIOPT Version :9

Sequence 1:XP_006510620.1 Gene:Kirrel3 / 67703 MGIID:1914953 Length:803 Species:Mus musculus
Sequence 2:NP_001260336.1 Gene:dpr19 / 34408 FlyBaseID:FBgn0032233 Length:385 Species:Drosophila melanogaster


Alignment Length:493 Identity:99/493 - (20%)
Similarity:154/493 - (31%) Gaps:165/493 - (33%)


- Green bases have known domain annotations that are detailed below.


Mouse     1 MRPFQLDLLFLCFFL-----FSQELG----LQKRGCCLVLGYMAKDKFRRMNEGQVYSFSQQPQD 56
            |.|.:..|...||.|     || ::|    .|..     .|...:.:|...|..:|         
  Fly     1 MEPKRWHLHLSCFLLLLSSTFS-DVGKITSSQNH-----FGNTLQSQFNTKNNTRV--------- 50

Mouse    57 QVVVSGQPVTLLCAIP-EYDGFVLWI--KDGLALGVGRDL-SSYPQYLVVGNHLSGEHHLKILRA 117
             :...|....|.|.:. .....|.||  ||...|.||... ||..::||......|...|:|...
  Fly    51 -IAQKGGLAILPCVVKVNSPATVSWIRRKDFQLLTVGLSTHSSDKRFLVEHTRHMGHWSLRIKAV 114

Mouse   118 ELQDDAVYECQAIQAAIRSRPARLTVLVPPDDPIILGGPVISLRAGDPLNLTCHADNA-KPAASI 181
            ..:|...||||......:|....|.::....:  |...|.:.:.....|.|.|....| :..|.:
  Fly   115 REEDRGFYECQLSIYPTQSIVIELKIVEAVAE--ISSAPELHIDETSTLRLECKLKRATENPAFV 177

Mouse   182 IWLRKGEVINGATYSKTLLRDGKRESIVSTLFISPGDVENGQSIVCRATNKAIPGGKETSVTIDI 246
            .|....::||         .|.:...:|::  |...:.::||                       
  Fly   178 FWYHDSKMIN---------YDSQGGFVVTS--IGQSNPQSGQ----------------------- 208

Mouse   247 QHPPLVNLSVEPQPVLEDNIVTFHCSAKANPAVTQYRWAKRGHIIKEASGELYRTTVDYTYFSEP 311
                                  |:.|:.||.:        |..:..|:|..:..:.:.   .|:.
  Fly   209 ----------------------FYRSSPANKS--------RATMPMESSNGVLNSLLG---SSDA 240

Mouse   312 VSCEVTNALGSTNLSRTVDVYFGPRMTSEPQSLLVDLGSDAVFSCAWIGNPSLTIVWMKRGSGVV 376
            :.....|...||           |.||.:.||             |::.|||:::          
  Fly   241 IKAPAANVPSST-----------PYMTQQHQS-------------AYLLNPSVSV---------- 271

Mouse   377 LSNEKTLTLKSVRQEDAGKYVCRAVVPRVGAGEREVTLTVNGPPIISSTQTQHALHGEKGQIKCF 441
                  ||:|.|....||.|.|      ..:..|..::||            |.|.|||      
  Fly   272 ------LTVKQVNFRHAGNYTC------APSNARPASITV------------HVLRGEK------ 306

Mouse   442 IRSTPPPDRIAWSWKENVLESGTSGRYTVETVNTEEGV 479
            ..:....:|.....:.|  .:||.|..|:..:|...||
  Fly   307 TAAMQHANRSILDTETN--GNGTFGLITLGGLNGTSGV 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Kirrel3XP_006510620.1 IG_like 54..143 CDD:214653 25/92 (27%)
Ig strand A' 56..60 CDD:409353 0/3 (0%)
Ig strand B 64..71 CDD:409353 2/6 (33%)
Ig strand C 78..82 CDD:409353 3/5 (60%)
Ig strand C' 84..87 CDD:409353 0/2 (0%)
Ig strand D 97..101 CDD:409353 0/3 (0%)
Ig strand E 104..116 CDD:409353 3/11 (27%)
Ig strand G 132..143 CDD:409353 2/10 (20%)
IgI_2_KIRREL3-like 149..246 CDD:409416 15/97 (15%)
Ig strand B 166..170 CDD:409416 2/3 (67%)
Ig strand C 180..184 CDD:409416 0/3 (0%)
Ig strand E 210..214 CDD:409416 0/3 (0%)
Ig strand F 224..229 CDD:409416 0/4 (0%)
Ig strand G 239..242 CDD:409416 0/2 (0%)
Ig <267..334 CDD:416386 11/66 (17%)
Ig strand B 267..274 CDD:409353 2/6 (33%)
Ig strand C 279..286 CDD:409353 0/6 (0%)
Ig strand C' 288..291 CDD:409353 0/2 (0%)
Ig strand D 298..302 CDD:409353 0/3 (0%)
Ig strand E 304..310 CDD:409353 0/5 (0%)
Ig strand G 321..334 CDD:409353 2/12 (17%)
Ig 335..416 CDD:416386 18/80 (23%)
Ig strand A' 343..347 CDD:409353 1/3 (33%)
Ig strand B 350..360 CDD:409353 1/9 (11%)
Ig strand C 365..371 CDD:409353 0/5 (0%)
Ig strand E 381..387 CDD:409353 2/5 (40%)
IgI_5_KIRREL3 418..515 CDD:409479 14/62 (23%)
Ig strand B 436..440 CDD:409479 0/3 (0%)
Ig strand C 450..454 CDD:409479 1/3 (33%)
Ig strand E 481..485 CDD:409479
Ig strand F 496..501 CDD:409479
Ig strand G 509..512 CDD:409479
dpr19NP_001260336.1 IG_like 50..127 CDD:214653 24/86 (28%)
IGc2 55..125 CDD:197706 21/69 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.