DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kirrel3 and DIP-theta

DIOPT Version :9

Sequence 1:XP_006510620.1 Gene:Kirrel3 / 67703 MGIID:1914953 Length:803 Species:Mus musculus
Sequence 2:NP_723103.1 Gene:DIP-theta / 33795 FlyBaseID:FBgn0051646 Length:606 Species:Drosophila melanogaster


Alignment Length:578 Identity:129/578 - (22%)
Similarity:208/578 - (35%) Gaps:163/578 - (28%)


- Green bases have known domain annotations that are detailed below.


Mouse    53 QPQDQVVVSGQPVTLLCAIPEYD----GFVLWIKDGLALGVGRD---------LSSY-------- 96
            |.:|:::...:..|::.||||.|    |.:|   ..:.:.|.|:         |.:|        
  Fly   106 QNKDELLEDIREDTVVNAIPEKDLPKFGELL---QNVTVPVSREAVLQCVVDNLQTYKIAWLRVD 167

Mouse    97 -PQYLVVGNH-LSGEHHLKILRAELQ------------DDAVYECQAIQAAIRSRPARLTVLVPP 147
             ...|.:.|| ::..|.:.|..||.:            |...|.||.....::|:...|.|:|||
  Fly   168 TQTILTIQNHVITKNHRMSITHAEKRAWILRIRDVKESDKGWYMCQINTDPMKSQVGYLDVVVPP 232

Mouse   148 DDPIILGGPV---ISLRAGDPLNLTCHADNAKPAASIIWLRK-GEVI---NGA---TYSKTLLRD 202
            |   ||..|.   :.:|.|..:.|.| |....|..:|.|.|: ||:|   |||   .|:.:.|..
  Fly   233 D---ILDYPTSTDMVIREGSNVTLKC-AATGSPTPTITWRREGGELIPLPNGAEAVAYNGSFLTI 293

Mouse   203 GKRESIVSTLFISPGDVENGQSIVCRATNKAIPGGKETSVTIDIQHPPLVNLSVEPQPV---LED 264
            .|    |:.|        |..:.:|.|:| .||......|.:.:..||::  .::.|.|   |..
  Fly   294 AK----VNRL--------NMGAYLCIASN-GIPPTVSKRVMLIVHFPPMI--WIQNQLVGAALTQ 343

Mouse   265 NIVTFHCSAKANPAVTQYRWAKRGHIIKEASGEL---------YRTTVDYTYFSEPVS------C 314
            || |..|.::|.|....| |.|...||  ..||.         |:.|:..|.:...:.      |
  Fly   344 NI-TLECQSEAYPKSINY-WMKNDTII--VPGERFVPETFESGYKITMRLTIYEVDIQDFGAYRC 404

Mouse   315 EVTNALGSTNLSRTVDVYFGPRMTSEPQSLLVDLGSDAVFSCAWIGNPSLTIVWMKRGSGVVLSN 379
            ...|:||.|:  ..:.:|..|:.|:                             |...:..|..|
  Fly   405 VAKNSLGDTD--GAIKLYHIPQTTT-----------------------------MTTMAPTVSIN 438

Mouse   380 EKTLTLKSVRQEDAGKYVCRAVVPRVGAGEREVTLTVNGPPIIS--STQTQHALHGEKGQIKCFI 442
            ...:.|....:|.           |.|:.:...|...|..|..|  :|:.|......||      
  Fly   439 TVPVVLVKYNKEQ-----------RYGSSQNSNTNPYNFNPGNSQQNTKLQRGKSNSKG------ 486

Mouse   443 RSTPPPDRIAWSWKENVLESGTSGRYTVETVNTEEGVISTLTISNIVRADFQTIYNCTAWNSFGS 507
             |...|     |...||....||..:..:..::...  |:.:.|:..|...|..::.....:.||
  Fly   487 -SDQSP-----SGLNNVFVGATSSLWNSQDHHSSSS--SSSSASSRGRDHHQQQHHQQQQQNHGS 543

Mouse   508 D----------------TEIIRLKEQGSEMKSGAGLEAESVPMAVIIGVAVGAGVAFL 549
            |                .:...|.:....|:...|..:...|::.|:|:::..||.:|
  Fly   544 DHGASYRSDGKSPHLTNHDAKSLTDDLDRMQDLKGWASRLSPISPILGLSMILGVGYL 601

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Kirrel3XP_006510620.1 IG_like 54..143 CDD:214653 26/123 (21%)
Ig strand A' 56..60 CDD:409353 1/3 (33%)
Ig strand B 64..71 CDD:409353 1/6 (17%)
Ig strand C 78..82 CDD:409353 1/3 (33%)
Ig strand C' 84..87 CDD:409353 0/2 (0%)
Ig strand D 97..101 CDD:409353 0/3 (0%)
Ig strand E 104..116 CDD:409353 4/12 (33%)
Ig strand G 132..143 CDD:409353 2/10 (20%)
IgI_2_KIRREL3-like 149..246 CDD:409416 30/106 (28%)
Ig strand B 166..170 CDD:409416 1/3 (33%)
Ig strand C 180..184 CDD:409416 1/3 (33%)
Ig strand E 210..214 CDD:409416 1/3 (33%)
Ig strand F 224..229 CDD:409416 1/4 (25%)
Ig strand G 239..242 CDD:409416 0/2 (0%)
Ig <267..334 CDD:416386 20/81 (25%)
Ig strand B 267..274 CDD:409353 2/6 (33%)
Ig strand C 279..286 CDD:409353 2/6 (33%)
Ig strand C' 288..291 CDD:409353 0/2 (0%)
Ig strand D 298..302 CDD:409353 1/12 (8%)
Ig strand E 304..310 CDD:409353 1/5 (20%)
Ig strand G 321..334 CDD:409353 3/12 (25%)
Ig 335..416 CDD:416386 10/80 (13%)
Ig strand A' 343..347 CDD:409353 0/3 (0%)
Ig strand B 350..360 CDD:409353 0/9 (0%)
Ig strand C 365..371 CDD:409353 1/5 (20%)
Ig strand E 381..387 CDD:409353 1/5 (20%)
IgI_5_KIRREL3 418..515 CDD:409479 20/114 (18%)
Ig strand B 436..440 CDD:409479 1/3 (33%)
Ig strand C 450..454 CDD:409479 0/3 (0%)
Ig strand E 481..485 CDD:409479 1/3 (33%)
Ig strand F 496..501 CDD:409479 0/4 (0%)
Ig strand G 509..512 CDD:409479 0/2 (0%)
DIP-thetaNP_723103.1 Ig 137..230 CDD:299845 18/92 (20%)
IG_like 137..230 CDD:214653 18/92 (20%)
IG_like 240..324 CDD:214653 27/97 (28%)
IGc2 247..310 CDD:197706 22/75 (29%)
Ig 327..419 CDD:299845 26/99 (26%)
IG_like 343..420 CDD:214653 21/82 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.