DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kirrel3 and DIP-eta

DIOPT Version :9

Sequence 1:XP_006510620.1 Gene:Kirrel3 / 67703 MGIID:1914953 Length:803 Species:Mus musculus
Sequence 2:NP_001188701.2 Gene:DIP-eta / 33793 FlyBaseID:FBgn0031725 Length:450 Species:Drosophila melanogaster


Alignment Length:459 Identity:110/459 - (23%)
Similarity:181/459 - (39%) Gaps:130/459 - (28%)


- Green bases have known domain annotations that are detailed below.


Mouse   206 ESIVSTLFISPGDVENGQSIVCRATNKAIPGGKE---TSVTIDIQHPPLVNLSVEPQPVL--EDN 265
            |.||...|.||            ..|...|.|::   |.|..|:....:..|.|:.|.:|  :::
  Fly    38 EVIVDPKFSSP------------IVNMTAPVGRDAFLTCVVQDLGPYKVAWLRVDTQTILTIQNH 90

Mouse   266 IVTFHCSAKANPAVTQYR-WAKRGHIIKEASGELYRTTVDYTYFSEPVSCEVTNALGSTNLSRTV 329
            ::|  .:.:...|.:::: |..|...|||:....|...::    ::|:..::          ..:
  Fly    91 VIT--KNQRIGIANSEHKTWTMRIKDIKESDKGWYMCQIN----TDPMKSQM----------GYL 139

Mouse   330 DVYFGPRMTSEPQS--LLVDLGSDAVFSCAWIGNPSLTIVWMKRGSGV---------VLSNEKT- 382
            ||...|.:...|.|  ::|..||:....||..|:|..||.| :|.|||         |:|.|.| 
  Fly   140 DVVVPPDILDYPTSTDMVVREGSNVTLKCAATGSPEPTITW-RRESGVPIELATGEEVMSIEGTD 203

Mouse   383 LTLKSVRQEDAGKYVCRA---VVPRVGAGEREVTLTVNGPPIIS-STQTQHALHGEKGQIKCFIR 443
            |.:.:||:...|.|:|.|   |.|.|   .:.:||.|:.||:|: ..|...|:.|:...:.|  .
  Fly   204 LVIPNVRRHHMGAYLCIASNGVPPSV---SKRITLVVHFPPMITVQNQLIGAVEGKGVTLDC--E 263

Mouse   444 STPPPDRIAWSWKE--NVLESGTSGRYTVETVNTEEGVIST---LTISNIVRADFQTIYNCTAWN 503
            |...|..|.:..:|  .::..|  |:|:...  ||.|....   |.|:.:.:|:|.: |.|.|.|
  Fly   264 SEAYPKSINYWTRERGEIVPPG--GKYSANV--TEIGGYRNSMRLHINPLTQAEFGS-YRCVAKN 323

Mouse   504 SFGSDTEIIRL------------------------------------KEQGSEM------KSGAG 526
            |.|.....|:|                                    :..|.:|      |:...
  Fly   324 SLGDTDGTIKLYRIPPNAVNYVENFEARHKGKKRTKSSESHHPARAQEHSGEDMENPGKRKADLS 388

Mouse   527 LEAESVPMAVIIGVAVGA-------GVAFLVL-MATIVAFCCARSQRSTGGRPGISGRGTEKKAR 583
            |.|||:. ::....|.|:       ||..|:| :|..||...|.:             |..::.:
  Fly   389 LGAESID-SIYGNSAAGSRRRQDLGGVLLLLLPVAVAVAMSLATA-------------GVMRETQ 439

Mouse   584 LRLP 587
            :.||
  Fly   440 MTLP 443

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Kirrel3XP_006510620.1 IG_like 54..143 CDD:214653
Ig strand A' 56..60 CDD:409353
Ig strand B 64..71 CDD:409353
Ig strand C 78..82 CDD:409353
Ig strand C' 84..87 CDD:409353
Ig strand D 97..101 CDD:409353
Ig strand E 104..116 CDD:409353
Ig strand G 132..143 CDD:409353
IgI_2_KIRREL3-like 149..246 CDD:409416 11/42 (26%)
Ig strand B 166..170 CDD:409416
Ig strand C 180..184 CDD:409416
Ig strand E 210..214 CDD:409416 0/3 (0%)
Ig strand F 224..229 CDD:409416 0/4 (0%)
Ig strand G 239..242 CDD:409416 1/5 (20%)
Ig <267..334 CDD:416386 11/67 (16%)
Ig strand B 267..274 CDD:409353 1/6 (17%)
Ig strand C 279..286 CDD:409353 1/7 (14%)
Ig strand C' 288..291 CDD:409353 0/2 (0%)
Ig strand D 298..302 CDD:409353 1/3 (33%)
Ig strand E 304..310 CDD:409353 0/5 (0%)
Ig strand G 321..334 CDD:409353 2/12 (17%)
Ig 335..416 CDD:416386 33/95 (35%)
Ig strand A' 343..347 CDD:409353 1/5 (20%)
Ig strand B 350..360 CDD:409353 3/9 (33%)
Ig strand C 365..371 CDD:409353 3/5 (60%)
Ig strand E 381..387 CDD:409353 2/6 (33%)
IgI_5_KIRREL3 418..515 CDD:409479 29/138 (21%)
Ig strand B 436..440 CDD:409479 0/3 (0%)
Ig strand C 450..454 CDD:409479 1/3 (33%)
Ig strand E 481..485 CDD:409479 1/6 (17%)
Ig strand F 496..501 CDD:409479 2/4 (50%)
Ig strand G 509..512 CDD:409479 0/2 (0%)
DIP-etaNP_001188701.2 Ig 51..141 CDD:299845 19/105 (18%)
IG_like 51..137 CDD:214653 19/101 (19%)
IG_like 153..237 CDD:214653 31/87 (36%)
Ig 161..224 CDD:299845 24/63 (38%)
IG_like 252..335 CDD:214653 24/89 (27%)
Ig 258..333 CDD:143165 21/81 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.