Sequence 1: | XP_006510620.1 | Gene: | Kirrel3 / 67703 | MGIID: | 1914953 | Length: | 803 | Species: | Mus musculus |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_787975.1 | Gene: | fipi / 33676 | FlyBaseID: | FBgn0031627 | Length: | 450 | Species: | Drosophila melanogaster |
Alignment Length: | 313 | Identity: | 79/313 - (25%) |
---|---|---|---|
Similarity: | 128/313 - (40%) | Gaps: | 54/313 - (17%) |
- Green bases have known domain annotations that are detailed below.
Mouse 253 NLSVEPQPVLEDNIVTF-------HCSAKANPAVTQYRWAKRGHIIKEASGELY--RTTVDY--T 306
Mouse 307 YFSEPV-------SCEVTNALGSTNLSRTVD--VYFGPRMTSEPQSLLVDLGSDAVFSCAWIGNP 362
Mouse 363 SLTIVWMKRGSGV-----------VLSNEKTLTLKSVRQEDAGKYVCRAV-VPRVGAG--EREVT 413
Mouse 414 LTVNGPPIISST---QTQHALHGEKGQIKCFIRSTPPPDRIAWSWKENVLESGTSGRYTVETVNT 475
Mouse 476 EEGVISTLTISNIVRADFQTIYNCTAWNSFGSDTEIIRLKEQGSEMKSGAGLE 528 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Kirrel3 | XP_006510620.1 | IG_like | 54..143 | CDD:214653 | |
Ig strand A' | 56..60 | CDD:409353 | |||
Ig strand B | 64..71 | CDD:409353 | |||
Ig strand C | 78..82 | CDD:409353 | |||
Ig strand C' | 84..87 | CDD:409353 | |||
Ig strand D | 97..101 | CDD:409353 | |||
Ig strand E | 104..116 | CDD:409353 | |||
Ig strand G | 132..143 | CDD:409353 | |||
IgI_2_KIRREL3-like | 149..246 | CDD:409416 | |||
Ig strand B | 166..170 | CDD:409416 | |||
Ig strand C | 180..184 | CDD:409416 | |||
Ig strand E | 210..214 | CDD:409416 | |||
Ig strand F | 224..229 | CDD:409416 | |||
Ig strand G | 239..242 | CDD:409416 | |||
Ig | <267..334 | CDD:416386 | 20/86 (23%) | ||
Ig strand B | 267..274 | CDD:409353 | 2/13 (15%) | ||
Ig strand C | 279..286 | CDD:409353 | 1/6 (17%) | ||
Ig strand C' | 288..291 | CDD:409353 | 1/2 (50%) | ||
Ig strand D | 298..302 | CDD:409353 | 0/5 (0%) | ||
Ig strand E | 304..310 | CDD:409353 | 1/7 (14%) | ||
Ig strand G | 321..334 | CDD:409353 | 6/14 (43%) | ||
Ig | 335..416 | CDD:416386 | 23/94 (24%) | ||
Ig strand A' | 343..347 | CDD:409353 | 0/3 (0%) | ||
Ig strand B | 350..360 | CDD:409353 | 2/9 (22%) | ||
Ig strand C | 365..371 | CDD:409353 | 1/5 (20%) | ||
Ig strand E | 381..387 | CDD:409353 | 1/5 (20%) | ||
IgI_5_KIRREL3 | 418..515 | CDD:409479 | 26/99 (26%) | ||
Ig strand B | 436..440 | CDD:409479 | 0/3 (0%) | ||
Ig strand C | 450..454 | CDD:409479 | 0/3 (0%) | ||
Ig strand E | 481..485 | CDD:409479 | 2/3 (67%) | ||
Ig strand F | 496..501 | CDD:409479 | 2/4 (50%) | ||
Ig strand G | 509..512 | CDD:409479 | 0/2 (0%) | ||
fipi | NP_787975.1 | IG_like | 33..115 | CDD:214653 | 18/85 (21%) |
I-set | 128..202 | CDD:254352 | 19/75 (25%) | ||
Ig | 133..>193 | CDD:299845 | 15/61 (25%) | ||
IG_like | 228..307 | CDD:214653 | 23/86 (27%) | ||
Ig | 235..305 | CDD:143165 | 20/76 (26%) | ||
FN3 | 312..415 | CDD:238020 | 2/8 (25%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |