DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kirrel3 and ed

DIOPT Version :10

Sequence 1:NP_001420714.1 Gene:Kirrel3 / 67703 MGIID:1914953 Length:803 Species:Mus musculus
Sequence 2:NP_523469.2 Gene:ed / 33619 FlyBaseID:FBgn0000547 Length:1332 Species:Drosophila melanogaster


Alignment Length:873 Identity:188/873 - (21%)
Similarity:299/873 - (34%) Gaps:257/873 - (29%)


- Green bases have known domain annotations that are detailed below.


Mouse    65 VTLLCAIPE----YDGFVLWIK--------DGLALG-----VGRDLSSYPQYLVVGNHLSGEHHL 112
            :||.|...:    .|....|.:        |.:|:|     .|..|...|:        .|.:.|
  Fly    54 LTLKCRFNDKYEANDFSFFWTRWTANPAQFDNVAIGEVQLSSGYRLDFQPE--------RGIYDL 110

Mouse   113 KILRAEL-QDDAVYEC----QAIQAAIRSRPARLTVLVPPDDPIILGGPVISLRAGDPLNLTCHA 172
            :|..... :|:..:||    :...|.:......||||.||..|:|..|.:.......|:.|||.:
  Fly   111 QIKNVSYNRDNGRFECRIKAKGTGADVHQEFHNLTVLTPPHPPVISPGNIAVATEDKPMELTCSS 175

Mouse   173 DNAKPAASIIWLRKGEVINGATYSKTLLRDG-KRESIVSTLFISPGDVENGQSIVCRATNKAIPG 236
            ....|..:|.|.|:|   :......|:|:.| |.:...:||.|.|...::|....|...|:|:..
  Fly   176 IGGSPDPTITWYREG---SNTPLPATVLKGGTKDQPTNATLSIIPRREDDGAKYKCVVRNRAMNE 237

Mouse   237 GK--ETSVTIDIQHPPLVNLSVE-PQPVLEDNIVTFHCSAKANPAVTQYRWAKRGHIIKEA-SGE 297
            ||  |.:.|:::.:.|.|.:..| |..|..|......|:..|.|.|...||.:.|..|..: ...
  Fly   238 GKRLEATATLNVNYYPRVEVGPENPLRVERDRTAKLECNVDAKPKVPNVRWNRNGRFISSSLVHT 302

Mouse   298 LYRTTVD----YTYFSEPVSCEVTNALGSTNLSRTV-DVYFGPRMTSEPQSLLVDLGSDAVFSCA 357
            ::|.:|.    ||       |...|.||.|.....: |:.:.|.:..|.::...:.|......|.
  Fly   303 IHRVSVQDAGKYT-------CIADNGLGKTGEQELILDILYPPMVVIESKTREAEEGDTVTIRCN 360

Mouse   358 WIGNPS-LTIVWMKRGSGVVLSNEKTLTLKSVRQEDAGKYVCRAV----------VPRVGAGERE 411
            ...||: :||.|:|..|.....|...|||.|||.:.||.|:||||          ..||  |...
  Fly   361 VTANPAPVTIEWLKENSPDFRYNGDVLTLTSVRADHAGNYICRAVNIMQSQGMERSERV--GNST 423

Mouse   412 VTLTVNGPPIISSTQTQHALHGEKGQIKCFIRSTPPPDRIAWSWKENVLESGTSGRYTVETVNTE 476
            |.|.|...|               ||  .:|....|                        .|:..
  Fly   424 VALLVRHRP---------------GQ--AYITPNKP------------------------VVHVG 447

Mouse   477 EGVISTLTISNIVRADFQTIYNCTAW------------NSFGSDTEIIRLKEQGSEMKSGAGLEA 529
            .||  |||.|          .|...|            ..|.|..:|:....|.|..|:..|.|.
  Fly   448 NGV--TLTCS----------ANPPGWPVPQYRWFRDMDGEFSSTQKILAQGPQYSIPKAHLGNEG 500

Mouse   530 ESVPMAVIIGVAVGAGVAFLVLMATIV-------AFCCARSQR--------------STGGRP-- 571
            :....||   ..:|.|     :|||||       .|.....|.              |..|:|  
  Fly   501 KYHCHAV---NELGIG-----MMATIVLEIHQPPQFLAKLQQHMTRRVADTDYTVTCSAKGKPAP 557

Mouse   572 --------------------------GISGRGT-EKKARLRLPRRANLKGVVSAKNDIRVEIVHK 609
                                      |::|..| :.:.:.|...|.|...:|.....:...:...
  Fly   558 SVKWLKDAVEILPEENLYEVQTNPDQGLNGMVTVQSQLKFRGKARPNGNALVPGDRGLYTCLYQN 622

Mouse   610 EPSSGREAE----DHTTIKQLMMDRGEF---QQDSVLKQLEVLKEEEKEFQNLKDP------TNG 661
            |.:|...:.    :|..|.....::..|   :...|:.:::...:.|.::|...:|      ::|
  Fly   623 EVNSANSSMQLRIEHEPIVLHQYNKVAFDIRETAEVVCKVQAYPKPEFQWQFGNNPSPLTMSSDG 687

Mouse   662 YYSVNTFKEHHS--TPTISLSS----------CQP-----------DLRPTGKQRVPTGMSFTNI 703
            :|.::|..:::.  |..:.::|          |:.           .|:..|....||.:..|.:
  Fly   688 HYEISTTTDNNDIYTSVLKINSLTHSDYGEYTCRVANTLDTIRAPIRLQQKGPPEKPTNLRATEV 752

Mouse   704 ---YSTLSGQGRLYDYGQRFVLGMGSSSIELCEREFQR----------GSLSDS-SSFLDTQCDS 754
               |.:||     :|.|  |..|:..:...:..|....          .:|::| |::::..|  
  Fly   753 GHNYVSLS-----WDPG--FDGGLSKTKFFVSYRRVAMPREEQLIPDCATLANSNSAWVEVDC-- 808

Mouse   755 SVSSSGKQDGYVQFDKASKASASSSHHS 782
                        |.|...|.:|...|.|
  Fly   809 ------------QRDIPCKVTALEQHQS 824

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Kirrel3NP_001420714.1 IG_like 54..143 CDD:214653 19/99 (19%)
Ig strand B 65..69 CDD:409390 2/3 (67%)
Ig strand C 73..81 CDD:409390 1/11 (9%)
Ig strand E 110..114 CDD:409390 1/3 (33%)
Ig strand F 124..129 CDD:409390 2/8 (25%)
Ig strand G 135..139 CDD:409390 0/3 (0%)
IgI_2_KIRREL3-like 149..246 CDD:409416 28/99 (28%)
Ig strand A 150..153 CDD:409416 1/2 (50%)
Ig strand A' 156..160 CDD:409416 0/3 (0%)
Ig strand B 167..174 CDD:409416 3/6 (50%)
Ig strand C 179..184 CDD:409416 1/4 (25%)
Ig strand C' 187..189 CDD:409416 1/1 (100%)
Ig strand D 192..199 CDD:409416 0/6 (0%)
Ig strand E 206..214 CDD:409416 2/7 (29%)
Ig strand F 223..231 CDD:409416 1/7 (14%)
Ig strand G 237..243 CDD:409416 3/7 (43%)
Ig <267..334 CDD:472250 18/72 (25%)
Ig strand B 267..271 CDD:409437 0/3 (0%)
Ig strand C 280..285 CDD:409437 1/4 (25%)
Ig strand E 304..308 CDD:409437 2/7 (29%)
Ig strand G 326..329 CDD:409437 0/2 (0%)
Ig 335..416 CDD:472250 30/91 (33%)
Ig strand B 352..356 CDD:409549 0/3 (0%)
Ig strand C 365..369 CDD:409549 2/3 (67%)
Ig strand E 381..385 CDD:409549 1/3 (33%)
IgI_5_KIRREL3 418..515 CDD:409479 17/108 (16%)
Ig strand A 419..423 CDD:409479 1/3 (33%)
Ig strand A' 425..428 CDD:409479 0/2 (0%)
Ig strand B 436..443 CDD:409479 2/6 (33%)
Ig strand C 450..455 CDD:409479 0/4 (0%)
Ig strand C' 457..460 CDD:409479 0/2 (0%)
Ig strand D 468..475 CDD:409479 1/6 (17%)
Ig strand E 478..485 CDD:409479 4/6 (67%)
Ig strand F 496..503 CDD:409479 2/18 (11%)
Ig strand G 506..513 CDD:409479 2/6 (33%)
edNP_523469.2 V-set 50..147 CDD:462230 20/100 (20%)
Ig 153..249 CDD:472250 28/98 (29%)
Ig strand B 169..173 CDD:409353 1/3 (33%)
Ig strand C 183..187 CDD:409353 1/3 (33%)
Ig strand E 211..215 CDD:409353 2/3 (67%)
Ig strand F 225..230 CDD:409353 1/4 (25%)
Ig strand G 242..245 CDD:409353 1/2 (50%)
Ig_3 253..320 CDD:464046 19/73 (26%)
Ig_3 337..406 CDD:464046 24/68 (35%)
Ig_2 437..>504 CDD:464026 19/102 (19%)
Ig 525..635 CDD:472250 14/109 (13%)
Ig strand B 545..549 CDD:409568 0/3 (0%)
Ig strand C 558..562 CDD:409568 0/3 (0%)
Ig strand E 587..591 CDD:409568 1/3 (33%)
Ig strand F 615..620 CDD:409568 0/4 (0%)
Ig strand G 628..631 CDD:409568 0/2 (0%)
Ig_3 639..724 CDD:464046 12/84 (14%)
FN3 741..848 CDD:238020 21/105 (20%)

Return to query results.
Submit another query.