DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kirrel3 and fred

DIOPT Version :9

Sequence 1:XP_006510620.1 Gene:Kirrel3 / 67703 MGIID:1914953 Length:803 Species:Mus musculus
Sequence 2:NP_608812.3 Gene:fred / 33613 FlyBaseID:FBgn0051774 Length:1447 Species:Drosophila melanogaster


Alignment Length:843 Identity:189/843 - (22%)
Similarity:315/843 - (37%) Gaps:205/843 - (24%)


- Green bases have known domain annotations that are detailed below.


Mouse    62 GQPVTLLCAIPEY----DGFVLWIK--------DGLALGVGRDLSSYPQYLVVGNHLSGEHHLKI 114
            |..:.|.|...|:    |....|.:        :.:|:|   |:.....|.:......|.:.|:|
  Fly    30 GVDLVLKCRFTEHYDSTDFTFYWARWTCCPTLFENVAIG---DVQLNSNYRLDFRPSRGIYDLQI 91

Mouse   115 LRAEL-QDDAVYEC----QAIQAAIRSRPARLTVLVPPDDPIILGGPVISLRAGDPLNLTCHADN 174
            ..... :|:..:||    :...|.:......||||..|..|::..|.:.......||.|||.:..
  Fly    92 KNTSYNRDNGRFECRIKAKGTGADVHQEFYNLTVL
TAPHPPMVTPGNLAVATEEKPLELTCSSIG 156

Mouse   175 AKPAASIIWLRKGEVINGATYSKTLLRDGKRESIV-STLFISPGDVENGQSIVCRATNKAIPGGK 238
            ..|...|.|.|:|..:...:|:   |:.|.:.... :||.|.|...::|....|...|:|:|.|.
  Fly   157 GSPDPMITWYREGSTVPLQSYA---LKGGSKNHYTNATLQIVPRRADDGAKYKCVVWNRAMPEGH 218

Mouse   239 --ETSVTIDIQHPPLVNLSVE-PQPVLEDNIVTFHCSAKANPAVTQYRWAKRGHIIKEA-SGELY 299
              |||||:::.:.|.|.:..: |..|..|::....|...|.|.|:..||::.|..:... :..:|
  Fly   219 MLETSVTLNV
NYYPRVEVGPQNPLKVERDHVAKLDCRVDAKPMVSNVRWSRNGQYVSATPTHTIY 283

Mouse   300 RTTVDYTYFSEPVSCEVTNALGSTNLSRTV-DVYFGPRMTSEPQSLLVDLGSDAVFSCAWIGNPS 363
            |..   .:.:...:|...|.||.|.....| ||.:.|.:..|.::...:.|...:..|....|||
  Fly   284 RVN---RHHAGKYTCSADNGLGKTGEKDIVLDV
LYPPIVFIESKTHEAEEGETVLIRCNVTANPS 345

Mouse   364 -LTIVWMKRGSGVVLSNEKTLTLKSVRQEDAGKYVCRAV-------VPRV-GAGEREVTLTV-NG 418
             :.:.|:|.|:.......:.|||.|||.|.||.|:||:|       ..|| |.|...|.|.| :.
  Fly   346 PINVEWLKEGAPDFRYTGELLTLGSVRAEHAGNYICRSVN
IMQPFSSKRVEGVGNSTVALLVRHR 410

Mouse   419 PPIISSTQTQHALH-GEKGQIKCFIRSTPPPDRIAW-----SW----------KENVLES----- 462
            |.....|..:..:| |....:.|   |..||   .|     .|          .:.:|..     
  Fly   411 PGQAYITPNKPVVHVGNGVTLTC---SANPP---GWPVPQYRWFRDMDGDIGNTQKILAQGPQYS 469

Mouse   463 ------GTSGRYTVETVNTEEGV--ISTLTI-------------SNIVR--ADFQTIYNCTAWNS 504
                  |:.|:|....|| |.|:  |:|:.:             .::.|  .|......|:|   
  Fly   470 IPKAHLGSEGKYHCHAVN-ELGIGKIATIILEVHQPPQFLAKLQQHMTRRVGDVDYAVTCSA--- 530

Mouse   505 FGSDTEIIRLKEQGSE-MKSGAGLEAESVPMAVIIGVAVGAGVAFLVLMATIVAFCCARSQRSTG 568
            .|..|..||..:.|:| :.:....:..:.|      ...|.||   |.:.:|:.|          
  Fly   531 KGKPTPQIRWIKDGTEILPTRKMFDIRTTP------TDAGGGV---VAVQSILRF---------- 576

Mouse   569 GRPGISGRGTEKKARLR----LPRRANL------KGVVSAKNDIRVEIVHKEPSSGREAEDHTTI 623
                   ||   |||..    ||....|      ..|.||.:.:.:.|.| ||         ..|
  Fly   577 -------RG---KARPNGNQLLPNDRGLYTCLYENDVNSANSSMHLRIEH-EP---------IVI 621

Mouse   624 KQLMMDRGEFQQDS-VLKQLEVLKEEEKEFQNLKDP------TNGYYSVNTFKEHHS--TPTISL 679
            .|......:.::.: |:.:::...:.|.::|...:|      ::|:|.::|..|::.  |..:.:
  Fly   622 HQYNKVAYDLRESAEVVCRVQAYPKPEFQWQYGNNPSPLTMSSDGHYEISTRMENNDVYTSILRI 686

Mouse   680 SSCQPD---------------------LRPTGKQRVPTGMSFTNI---YSTLSGQGRLYDYGQRF 720
            :..|..                     |:|.|....||.:....:   |:.|       ::...|
  Fly   687 AHLQHSDYGEYICRAVNPLDSIRAPIRLQPKGSPEKPTNLKILEVGHNYAVL-------NWTPGF 744

Mouse   721 VLGMGSSSIELCEREF---QRGSLSDSSSFLDTQCDSSVSSSGKQDGYVQFDKASKASASSSH 780
            ..|..|:...:..|..   :..:|||.|.                :||:...:.|.:|::|:|
  Fly   745 NGGFMSTKYLVSYRRVATPREQTLSDCSG----------------NGYIPSYQISSSSSNSNH 791

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Kirrel3XP_006510620.1 IG_like 54..143 CDD:214653 18/97 (19%)
Ig strand A' 56..60 CDD:409353
Ig strand B 64..71 CDD:409353 2/6 (33%)
Ig strand C 78..82 CDD:409353 1/3 (33%)
Ig strand C' 84..87 CDD:409353 0/2 (0%)
Ig strand D 97..101 CDD:409353 1/3 (33%)
Ig strand E 104..116 CDD:409353 3/11 (27%)
Ig strand G 132..143 CDD:409353 2/10 (20%)
IgI_2_KIRREL3-like 149..246 CDD:409416 30/99 (30%)
Ig strand B 166..170 CDD:409416 2/3 (67%)
Ig strand C 180..184 CDD:409416 1/3 (33%)
Ig strand E 210..214 CDD:409416 2/3 (67%)
Ig strand F 224..229 CDD:409416 1/4 (25%)
Ig strand G 239..242 CDD:409416 2/2 (100%)
Ig <267..334 CDD:416386 17/68 (25%)
Ig strand B 267..274 CDD:409353 1/6 (17%)
Ig strand C 279..286 CDD:409353 3/6 (50%)
Ig strand C' 288..291 CDD:409353 1/2 (50%)
Ig strand D 298..302 CDD:409353 2/3 (67%)
Ig strand E 304..310 CDD:409353 0/5 (0%)
Ig strand G 321..334 CDD:409353 5/13 (38%)
Ig 335..416 CDD:416386 29/89 (33%)
Ig strand A' 343..347 CDD:409353 0/3 (0%)
Ig strand B 350..360 CDD:409353 1/9 (11%)
Ig strand C 365..371 CDD:409353 1/5 (20%)
Ig strand E 381..387 CDD:409353 3/5 (60%)
IgI_5_KIRREL3 418..515 CDD:409479 28/140 (20%)
Ig strand B 436..440 CDD:409479 0/3 (0%)
Ig strand C 450..454 CDD:409479 1/8 (13%)
Ig strand E 481..485 CDD:409479 1/3 (33%)
Ig strand F 496..501 CDD:409479 1/4 (25%)
Ig strand G 509..512 CDD:409479 1/2 (50%)
fredNP_608812.3 Ig 29..126 CDD:299845 19/98 (19%)
IG_like 141..228 CDD:214653 28/89 (31%)
Ig 147..228 CDD:299845 28/83 (34%)
I-set 232..313 CDD:254352 20/83 (24%)
IGc2 250..302 CDD:197706 11/54 (20%)
IG_like 323..385 CDD:214653 20/61 (33%)
IGc2 330..385 CDD:197706 20/54 (37%)
Ig_2 416..501 CDD:290606 19/91 (21%)
IG_like 418..501 CDD:214653 18/89 (20%)
I-set 505..612 CDD:254352 28/138 (20%)
Ig 526..611 CDD:143165 26/116 (22%)
IG_like 633..715 CDD:214653 10/81 (12%)
Ig 635..713 CDD:143165 10/77 (13%)
FN3 720..838 CDD:238020 18/95 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167838619
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.