DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Kirrel3 and dpr3

DIOPT Version :9

Sequence 1:	XP_006510620.1	Gene:	Kirrel3 / 67703	MGIID:	1914953	Length:	803	Species:	Mus musculus
Sequence 2:	NP_001014459.2	Gene:	dpr3 / 3346208	FlyBaseID:	FBgn0053516	Length:	522	Species:	Drosophila melanogaster

Alignment Length:	198	Identity:	45/198 - (22%)
Similarity:	74/198 - (37%)	Gaps:	46/198 - (23%)

- Green bases have known domain annotations that are detailed below.

Mouse    74 YDGFVLWI--KDGLALGVG-RDLSSYPQYLVVGNHLSGEHHLKILRAELQDDAVYECQAIQAAIR 135
            :|..|.||  :|...|.|| ...:|..::.|..:..|.|..|.:.....:|..:||||.......
  Fly   265 HDKSVSWIRKRDLHILTVGTATYTSDKRFQVTESKDSREWTLHVKAPLAKDSGIYECQVNTEPKM 329

Mouse   136 SRPARLTVL-VPPDDPIILGGPV-ISLRAGDPLNLTC--HADNAKPAASIIWLRKGEVINGATYS 196
            |...:|.:: :.||...::.||. :..:||..:.|.|  ...:.|....|.|.| ||.:
  Fly   330 SMAFQLNIIEISPDAKAVISGPPDLHFKAGSAIILNCLVQQPSVKDIGPIYWYR-GEHM------ 387

Mouse   197 KTLLRDGKRESIVSTLFISPGDVENGQSIVCRATNKAIPGGKETSVTIDIQHPPLVNLSVEPQPV 261
                             |:|.|.::||        ..||.|:.       :||..:.....|..:
  Fly   388 -----------------ITPFDADDGQ--------PEIPAGRG-------EHPQGIPEDTSPNDI 420

Mouse   262 LED 264
            :.:
  Fly   421 MSE 423

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Kirrel3	XP_006510620.1	IG_like	54..143	CDD:214653	20/71 (28%)
		Ig strand A'	56..60	CDD:409353
		Ig strand B	64..71	CDD:409353
		Ig strand C	78..82	CDD:409353	3/5 (60%)
		Ig strand C'	84..87	CDD:409353	0/2 (0%)
		Ig strand D	97..101	CDD:409353	0/3 (0%)
		Ig strand E	104..116	CDD:409353	3/11 (27%)
		Ig strand G	132..143	CDD:409353	2/10 (20%)
		IgI_2_KIRREL3-like	149..246	CDD:409416	20/99 (20%)
		Ig strand B	166..170	CDD:409416	1/3 (33%)
		Ig strand C	180..184	CDD:409416	1/3 (33%)
		Ig strand E	210..214	CDD:409416	0/3 (0%)
		Ig strand F	224..229	CDD:409416	0/4 (0%)
		Ig strand G	239..242	CDD:409416	0/2 (0%)
		Ig	<267..334	CDD:416386
		Ig strand B	267..274	CDD:409353
		Ig strand C	279..286	CDD:409353
		Ig strand C'	288..291	CDD:409353
		Ig strand D	298..302	CDD:409353
		Ig strand E	304..310	CDD:409353
		Ig strand G	321..334	CDD:409353
		Ig	335..416	CDD:416386
		Ig strand A'	343..347	CDD:409353
		Ig strand B	350..360	CDD:409353
		Ig strand C	365..371	CDD:409353
		Ig strand E	381..387	CDD:409353
		IgI_5_KIRREL3	418..515	CDD:409479
		Ig strand B	436..440	CDD:409479
		Ig strand C	450..454	CDD:409479
		Ig strand E	481..485	CDD:409479
		Ig strand F	496..501	CDD:409479
		Ig strand G	509..512	CDD:409479
dpr3	NP_001014459.2	Ig	243..330	CDD:299845	18/64 (28%)
		IG_like	243..329	CDD:214653	18/63 (29%)
		Ig	350..464	CDD:299845	23/113 (20%)
		IG_like	<441..477	CDD:214653
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG3510
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	2	1.810