DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rnf149 and H10E21.5

DIOPT Version :9

Sequence 1:NP_001028307.2 Gene:Rnf149 / 67702 MGIID:2677438 Length:394 Species:Mus musculus
Sequence 2:NP_497129.1 Gene:H10E21.5 / 175169 WormBaseID:WBGene00019185 Length:473 Species:Caenorhabditis elegans


Alignment Length:311 Identity:94/311 - (30%)
Similarity:143/311 - (45%) Gaps:76/311 - (24%)


- Green bases have known domain annotations that are detailed below.


Mouse    82 PAPAEGCAPDTRFVAPGALGNAPWVALVARGGCTFKDKVLAAARRNASAVVVYNLESNGNATEPM 146
            ||..:.||||.:|                                :.|..|.:......|....:
 Worm    62 PAYTDLCAPDMKF--------------------------------DDSQRVFFCKNCIQNCLSRV 94

Mouse   147 SHAGTGNIVVIMISYPKGREIFDLVQKGIPVKMRIEIG------------------TRHMQEFIS 193
            ..|....::|..:..|..|..:..||  .||....|.|                  |..::.| |
 Worm    95 ETAPKNILIVADVKAPNNRVSWFHVQ--TPVSNIRESGKQCNVENSNAMQSPEETSTDALRSF-S 156

Mouse   194 GQSVVFVAIAFITMMIISLAWLIFYYIQRFLYTGSQFGSQNHRKE---------TKKVIGQLPLH 249
            ..||:||:|:||.:|:||||||:|||:|||.|.        |.|:         .:|.:.::|..
 Worm   157 KTSVLFVSISFIILMVISLAWLVFYYVQRFRYA--------HAKDRLQRRLFNAARKALTRIPTM 213

Mouse   250 TVKHG-EKGIDVDAENCAVCIENFKVKDVIRILPCKHIFHRICIDPWLLDHRTCPMCKLDVIKAL 313
            |:..| .:.:..|   ||||::.::::||||:||||||:|:.|||||||:||||||||.|::|..
 Worm   214 TITPGMTQELQSD---CAVCLDPYQLQDVIRLLPCKHIYHKSCIDPWLLEHRTCPMCKNDILKHF 275

Mouse   314 GYWGDPEDTQELPTPEAAPGRVSVGNLSVTSQDEERSESNL--PSSSSSES 362
            |||.|..:..::||............|.:..|:.:...:::  |.::|..|
 Worm   276 GYWNDIRNDIQMPTNSRGIADDFTIRLELGEQEHQAPSADVISPEANSDTS 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rnf149NP_001028307.2 PA_GRAIL_like 45..181 CDD:239037 18/98 (18%)
UPF0233 <193..>220 CDD:299753 17/26 (65%)
zf-RING_2 263..306 CDD:290367 28/42 (67%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 321..394 7/44 (16%)
H10E21.5NP_497129.1 HRD1 <150..325 CDD:227568 72/186 (39%)
RING-H2_GRAIL 226..273 CDD:319582 32/49 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 84 1.000 Domainoid score I5750
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000832
OrthoInspector 1 1.000 - - otm16989
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22765
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X295
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
87.970

Return to query results.
Submit another query.