DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ZFP36L1 and Tis11

DIOPT Version :9

Sequence 1:NP_001231630.1 Gene:ZFP36L1 / 677 HGNCID:1107 Length:407 Species:Homo sapiens
Sequence 2:NP_001259490.1 Gene:Tis11 / 32222 FlyBaseID:FBgn0011837 Length:436 Species:Drosophila melanogaster


Alignment Length:409 Identity:134/409 - (32%)
Similarity:186/409 - (45%) Gaps:107/409 - (26%)


- Green bases have known domain annotations that are detailed below.


Human    80 FDLSEVLCKGNKMLNYSAPSAGGCLLDRKAVGTP--AGGGFPRRHSVTLPSSKFHQNQLLSSLKG 142
            ||.:||. |..:||     .|.|..||::....|  ..||..|  :::.|:....|.|.....:.
  Fly    36 FDCNEVR-KEIRML-----LAHGANLDQQHQQQPHRHHGGLTR--TISQPAQLIQQQQQQHQQQQ 92

Human   143 EPAPALSSRDS-----------RFRDRSFSEGGERLLPTQKQPGGGQVNSSRYKTELCRPFEENG 196
            :..||::|..:           |..:|:.||.    ||.| ||    :|:|||||||||||||.|
  Fly    93 QQQPAVASLVTITENLGNMNLHRKLERTQSEP----LPPQ-QP----MNTSRYKTELCRPFEEAG 148

Human   197 ACKYGDKCQFAHGIHELRSLTRHPKYKTELCRTFHTIGFCPYGPRCHFIHNAEERR---ALAGAR 258
            .||||:|||||||.||||::.||||||||.|||||::|||||||||||:|||:|.|   |...|:
  Fly   149 ECKYGEKCQFAHGSHELRNVHRHPKYKTEYCRTFHSVGFCPYGPRCHFVHNADEARAQQAAQAAK 213

Human   259 DLSADRPRLQHSFS--FAGFPSAAATAAATGLLDSPTS---------------------ITPPPI 300
            ..:..:.:.|.|.|  |:...:.::..::.....|.:|                     ::||..
  Fly   214 SSTQSQSQSQQSSSQNFSPKSNQSSNQSSNSSSSSSSSGGGGGGGNSINNNNGSQFYLPLSPPLS 278

Human   301 LSADDLLGSPT-----LPDGTNNPFAF----------------SSQELASLFAPSMGL------- 337
            :|......|||     .|..:...|.|                :|...::..|..|||       
  Fly   279 MSTGSDRESPTGSLSLSPTNSLTSFPFHDALQHGYLASNGAKSNSSASSTSSASGMGLGMSMGIG 343

Human   338 ----------PGGGSPTTFLFRPMSESPHMFDSP---PSPQDSLSDQEGYLSSSSSS-----HSG 384
                      .|...|.|     ..|||::..||   |.|.|.:....|..::|..|     .|.
  Fly   344 QGMIIGQGLGMGHHGPAT-----PPESPNVPISPVHTPPPYDVVVSGSGAGNNSVGSKQLLQKSV 403

Human   385 SDSPTLDNSRRLPIFSRLS 403
            |.....:::.|||:|:|||
  Fly   404 STPMQQEDTPRLPVFNRLS 422

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZFP36L1NP_001231630.1 Tis11B_N 72..168 CDD:282420 25/100 (25%)
zf-CCCH 184..209 CDD:279036 21/24 (88%)
zf-CCCH 222..246 CDD:279036 20/23 (87%)
Tis11NP_001259490.1 zf-CCCH 136..161 CDD:279036 21/24 (88%)
zf-CCCH 174..198 CDD:279036 20/23 (87%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 61 1.000 Domainoid score I10475
eggNOG 1 0.900 - - E1_COG5063
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000616
OrthoInspector 1 1.000 - - otm41180
orthoMCL 1 0.900 - - OOG6_101179
Panther 1 1.100 - - LDO PTHR12547
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2078
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
98.800

Return to query results.
Submit another query.