DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ST14 and CG11841

DIOPT Version :10

Sequence 1:NP_068813.1 Gene:ST14 / 6768 HGNCID:11344 Length:855 Species:Homo sapiens
Sequence 2:NP_651661.1 Gene:CG11841 / 43430 FlyBaseID:FBgn0039628 Length:319 Species:Drosophila melanogaster


Alignment Length:265 Identity:67/265 - (25%)
Similarity:112/265 - (42%) Gaps:54/265 - (20%)


- Green bases have known domain annotations that are detailed below.


Human   615 VVGGTDADEGEWPWQVSLHALGQGH---------ICGASLISPNWLVSAAHCYIDDRG------- 663
            :|.||.|:..|:|:...|     ||         .||.:|||...:::||||:..:.|       
  Fly    72 IVDGTPAEPKEFPFAARL-----GHRKTNNEIKWFCGGTLISNRLVLTAAHCFFSEHGEVNVVRL 131

Human   664 --FRYSDPTQWTAFLGLHDQSQRSAPGVQERRLKRIISHPFFNDFTFDYDIALLELEKPAEYSSM 726
              ..:...|         |.::....||...:     :||.|.:.....||.:::|::..:::..
  Fly   132 GELEFDTDT---------DDAEPEDFGVLALK-----AHPGFENPQLYNDIGIVQLDREVKFNRY 182

Human   727 VRPICLPDASHVFPAG---KAIWVTGWGHTQYGGTGALILQKGEI-----RVINQTTCENLLPQQ 783
            ..|.|||     |..|   ::....|||..::....:..|.|.::     |.::.....:.||..
  Fly   183 KHPACLP-----FDDGEQHESFIAIGWGQKKFAQKESKKLLKVQLQGYKDRCVSSVDANDELPNG 242

Human   784 ITPR-MMCVGFLSGGVDSCQGDSGGPLSSVEADGRIFQ--AGVVSWGDGCAQRNKPGVYTRLPLF 845
            ..|: .:|:| .....|:|.||||||:.:...|.....  .|:.|.|..|:..:.|..|||:..|
  Fly   243 YEPKSQLCIG-SRDNKDTCNGDSGGPVLAYHKDLACMYHVMGITSAGITCSTPDIPSAYTRVHYF 306

Human   846 RDWIK 850
            .:|||
  Fly   307 LNWIK 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ST14NP_068813.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20
SEA 88..>162 CDD:460188
CUB 227..332 CDD:238001
CUB 340..444 CDD:238001
LDLa 454..486 CDD:238060
LDLa 488..523 CDD:238060
LDLa 525..559 CDD:238060
LDLa 567..602 CDD:238060
Tryp_SPc 615..852 CDD:238113 67/265 (25%)
CG11841NP_651661.1 Tryp_SPc 72..311 CDD:238113 65/263 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.