DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ST14 and CG31266

DIOPT Version :10

Sequence 1:NP_068813.1 Gene:ST14 / 6768 HGNCID:11344 Length:855 Species:Homo sapiens
Sequence 2:NP_001138068.1 Gene:CG31266 / 42071 FlyBaseID:FBgn0051266 Length:282 Species:Drosophila melanogaster


Alignment Length:256 Identity:78/256 - (30%)
Similarity:114/256 - (44%) Gaps:26/256 - (10%)


- Green bases have known domain annotations that are detailed below.


Human   605 GLRSFTR--------QARVVGGTDADEGEWPWQVSLHALGQGHICGASLISPNWLVSAAHCYIDD 661
            ||.:..|        |.||:|||.|.||.|||..|:......|:|||.::...|:::||.|.   
  Fly    34 GLANIERHRSTEAVPQGRVIGGTTAAEGNWPWIASIQNAYSYHLCGAIILDETWVLTAASCV--- 95

Human   662 RGFRYSDPTQWTAFLGLHDQSQRSAPGVQERRLKRIISHPFFNDFTFDYDIALLELEKPAEYSSM 726
            .|.|   |.......|..|.....||   ...:.:|..|..|:...:..|||||:|....|::.:
  Fly    96 AGLR---PLNLLVVTGTVDWWDLYAP---YYTVSQIHVHCNFDKPLYHNDIALLQLSSKIEFNDV 154

Human   727 VRPICLPDASHVFPAGKAIWVTGWGHTQYGGTGALILQKGEIRVINQTTCENLLPQQ--ITPRMM 789
            .:.|.|.|...: ..|..:...|||.::..||....||:.....:....|...|..|  :....:
  Fly   155 TKNITLADIDEL-EEGDKLTFAGWGSSEAMGTYGRYLQEASGTYLPVDACREKLQNQDDVDLGHV 218

Human   790 CVGFLSGGVDSCQGDSGGPLSSVEADGRIFQAGVVSWGDGCAQRNKPGVYTRLPLFRDWIK 850
            ||. :..|..:|.||:||||  ::...|:  .|:.:||..|. |..|.||.|...:.|||:
  Fly   219 CVQ-MDAGQGACHGDTGGPL--IDEQQRL--VGIGNWGVPCG-RGYPDVYARTAFYHDWIR 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ST14NP_068813.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20
SEA 88..>162 CDD:460188
CUB 227..332 CDD:238001
CUB 340..444 CDD:238001
LDLa 454..486 CDD:238060
LDLa 488..523 CDD:238060
LDLa 525..559 CDD:238060
LDLa 567..602 CDD:238060
Tryp_SPc 615..852 CDD:238113 73/238 (31%)
CG31266NP_001138068.1 Tryp_SPc 52..275 CDD:238113 73/238 (31%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.