DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ST14 and Sb

DIOPT Version :10

Sequence 1:NP_068813.1 Gene:ST14 / 6768 HGNCID:11344 Length:855 Species:Homo sapiens
Sequence 2:NP_476709.1 Gene:Sb / 41958 FlyBaseID:FBgn0003319 Length:787 Species:Drosophila melanogaster


Alignment Length:263 Identity:102/263 - (38%)
Similarity:153/263 - (58%) Gaps:21/263 - (7%)


- Green bases have known domain annotations that are detailed below.


Human   603 DCGLRSFTR-QARVVGGTDADEGEWPWQVSLH-----ALGQGHICGASLISPNWLVSAAHCYIDD 661
            :||:.:..| :.|:|||..|..|.||||||:.     .....|.||.:||:.||:.:|.|| :||
  Fly   531 ECGVPTLARPETRIVGGKSAAFGRWPWQVSVRRTSFFGFSSTHRCGGALINENWIATAGHC-VDD 594

Human   662 RGFRYSDPTQWTAFLGLHDQS--QRSAPGVQERRLKRIISHPFFNDFTFDYDIALLELEKPAEYS 724
            ...     :|....:|.:|.|  |...|.::....|::: ||.::..|::||:||::||:|.|::
  Fly   595 LLI-----SQIRIRVGEYDFSHVQEQLPYIERGVAKKVV-HPKYSFLTYEYDLALVKLEQPLEFA 653

Human   725 SMVRPICLPDASHVFPAGKAIWVTGWGHTQYGGTGALILQKGEIRVINQTTCENLL----PQQIT 785
            ..|.|||||:...:. .|....|||||....|||...:||:..:.:::...|:::.    .|:..
  Fly   654 PHVSPICLPETDSLL-IGMNATVTGWGRLSEGGTLPSVLQEVSVPIVSNDNCKSMFMRAGRQEFI 717

Human   786 PRM-MCVGFLSGGVDSCQGDSGGPLSSVEADGRIFQAGVVSWGDGCAQRNKPGVYTRLPLFRDWI 849
            |.: :|.|:.:||.|||||||||||.:...|||.|.||::|||.|||:.|.|||.||:..|..||
  Fly   718 PDIFLCAGYETGGQDSCQGDSGGPLQAKSQDGRFFLAGIISWGIGCAEANLPGVCTRISKFTPWI 782

Human   850 KEN 852
            .|:
  Fly   783 LEH 785

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ST14NP_068813.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20
SEA 88..>162 CDD:460188
CUB 227..332 CDD:238001
CUB 340..444 CDD:238001
LDLa 454..486 CDD:238060
LDLa 488..523 CDD:238060
LDLa 525..559 CDD:238060
LDLa 567..602 CDD:238060
Tryp_SPc 615..852 CDD:238113 97/248 (39%)
SbNP_476709.1 Tryp_SPc 544..785 CDD:238113 97/248 (39%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.