DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ST14 and CG9631

DIOPT Version :10

Sequence 1:NP_068813.1 Gene:ST14 / 6768 HGNCID:11344 Length:855 Species:Homo sapiens
Sequence 2:NP_650345.1 Gene:CG9631 / 41729 FlyBaseID:FBgn0027563 Length:439 Species:Drosophila melanogaster


Alignment Length:269 Identity:71/269 - (26%)
Similarity:120/269 - (44%) Gaps:38/269 - (14%)


- Green bases have known domain annotations that are detailed below.


Human   603 DCGLRSFTRQARVVGGTDADEGEWPWQVSLHALGQG---HICGASLISPNWLVSAAHCYIDDRGF 664
            :||:..|:  ...:||.....|::||..:|:. |.|   :.|..|:||...:::||||...    
  Fly   187 ECGVEGFS--PLQIGGDLVTRGQYPWLAALYE-GVGTATYKCVVSVISKRTVITAAHCIYG---- 244

Human   665 RYSDPTQWTAFLGLHDQSQRSAPGVQERRLKRIISHPFFNDFTF-DYDIALLELEKPAEYSSMVR 728
              ...:|...:||.||:::....|.....:..:::...:..... |.|:.||.|..|..|:..:|
  Fly   245 --KSASQLWVYLGRHDRNENPENGASLVSVTSVLTPSAYEGNPVPDADVGLLVLTSPMVYTKYIR 307

Human   729 PICLPDASHVFP--AGKAIWVTGWGH------TQYGGTGALILQKGEIRVINQTTCENLLPQQ-- 783
            |:||..::...|  .|....|.|||:      |::..|.:       :|::.:..|...:.:.  
  Fly   308 PLCLWGSNMGLPPNEGDTGAVAGWGYDRSAQKTRFPKTVS-------VRLVPRDQCLKEMKRAED 365

Human   784 -ITPRMMCVGFLSGGVDSCQGDSGGPLSSVEADGRIFQAGVVS----WGDGCAQRNKPGVYTRLP 843
             ||.|.:|.| .|.....|.||||..| .|..:.|.:..||||    .|:.| ..:|..:|..:.
  Fly   366 FITRRTVCAG-NSESHGPCFGDSGSAL-IVLRNNRWYVRGVVSLSPRHGEIC-DLSKYVIYCDVA 427

Human   844 LFRDWIKEN 852
            ...||:::|
  Fly   428 RHIDWVRQN 436

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ST14NP_068813.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20
SEA 88..>162 CDD:460188
CUB 227..332 CDD:238001
CUB 340..444 CDD:238001
LDLa 454..486 CDD:238060
LDLa 488..523 CDD:238060
LDLa 525..559 CDD:238060
LDLa 567..602 CDD:238060
Tryp_SPc 615..852 CDD:238113 67/255 (26%)
CG9631NP_650345.1 GD_N 26..132 CDD:464985
Tryp_SPc 198..436 CDD:238113 67/254 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.