DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ST14 and CG16749

DIOPT Version :10

Sequence 1:NP_068813.1 Gene:ST14 / 6768 HGNCID:11344 Length:855 Species:Homo sapiens
Sequence 2:NP_649881.1 Gene:CG16749 / 41111 FlyBaseID:FBgn0037678 Length:265 Species:Drosophila melanogaster


Alignment Length:254 Identity:82/254 - (32%)
Similarity:129/254 - (50%) Gaps:31/254 - (12%)


- Green bases have known domain annotations that are detailed below.


Human   611 RQARVVGGTDADEGEWPWQVSLHALGQGHICGASLISPNWLVSAAHCYIDDRGFRYSDPTQWTAF 675
            :..|||.|||:...::|:.:|:......|.||.|:||..::::||||   ..|.:.||       
  Fly    26 QMGRVVNGTDSSVEKYPFVISMRGSSGSHSCGGSIISKQFVMTAAHC---TDGRKASD------- 80

Human   676 LGL-HDQSQRSAPGVQERRLKRIISHPFFNDF-TFDYDIALLELEKPAEYSSM-VRPICLPDASH 737
            |.: :..::.:|.|....|:|:||.|..:|.: .:..||:||.:|:|.|:..: |.|:.||:.:.
  Fly    81 LSVQYGVTKINATGPNVVRVKKIIQHEDYNPYNNYANDISLLLVEEPFEFDGVTVAPVKLPELAF 145

Human   738 VFP----AGKAIWVTGWGHTQYGGTGALILQKGEIRVINQTTCENLLPQQITPRM-MCVGFLSGG 797
            ..|    .|:.:.: |||....||.....||:.|::|.:...|......:..||. :|.|...||
  Fly   146 ATPQTDAGGEGVLI-GWGLNATGGYIQSTLQEVELKVYSDEECTERHGGRTDPRYHICGGVDEGG 209

Human   798 VDSCQGDSGGPLSSVEADGRIF---QAGVVSWG-DGCAQRNKPGVYTRLPLFRDWIKEN 852
            ...|.|||||||        |:   |.|:|||. ..|.....||||.::..:.||||::
  Fly   210 KGQCSGDSGGPL--------IYNGQQVGIVSWSIKPCTVAPYPGVYCKVSQYVDWIKKS 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ST14NP_068813.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20
SEA 88..>162 CDD:460188
CUB 227..332 CDD:238001
CUB 340..444 CDD:238001
LDLa 454..486 CDD:238060
LDLa 488..523 CDD:238060
LDLa 525..559 CDD:238060
LDLa 567..602 CDD:238060
Tryp_SPc 615..852 CDD:238113 81/248 (33%)
CG16749NP_649881.1 Tryp_SPc 30..259 CDD:238113 80/247 (32%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.