DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ST14 and CG12951

DIOPT Version :10

Sequence 1:NP_068813.1 Gene:ST14 / 6768 HGNCID:11344 Length:855 Species:Homo sapiens
Sequence 2:NP_649880.1 Gene:CG12951 / 41110 FlyBaseID:FBgn0037677 Length:265 Species:Drosophila melanogaster


Alignment Length:254 Identity:80/254 - (31%)
Similarity:121/254 - (47%) Gaps:35/254 - (13%)


- Green bases have known domain annotations that are detailed below.


Human   613 ARVVGGTDADEGEWPWQVSLHALGQGHICGASLISPNWLVSAAHCY----IDDRGFRYSDPTQWT 673
            :|||.|||:...::|:.|||.:....|.||.|:||.:::::||||.    .|....::.      
  Fly    28 SRVVNGTDSSVLKYPFVVSLRSYDGSHSCGGSIISKHFVMTAAHCTNGRPADTLSIQFG------ 86

Human   674 AFLGLHDQSQRSAPGVQERRLKRIISHPFFNDFTFD-YDIALLELEKPAEYSSM-VRPICLPDAS 736
                   .:..||.|.....:|:||.|..|:....: .||:||.:|:|.|:..: |.|:.||..:
  Fly    87 -------VTNISAMGPNVVGIKKIIQHEDFDPTRQNANDISLLMVEEPFEFDGVSVAPVELPALA 144

Human   737 HVFP---AGKAIWVTGWGHTQYGGTGALILQKGEIRVINQTTCENLLPQQITPRM-MCVGFLSGG 797
            ...|   ||....:.|||.....|:....||:..:::.:...|.:....|..|:. :|.|...||
  Fly   145 FAVPQSDAGVEGVLIGWGLNDTYGSVQDTLQEVSLKIYSDEECTSRHNGQTDPKYHICGGVDEGG 209

Human   798 VDSCQGDSGGPLSSVEADGRIF---QAGVVSWG-DGCAQRNKPGVYTRLPLFRDWIKEN 852
            ...|.|||||||        |:   |.|:|||. ..|.....||||.::..:.||||.|
  Fly   210 KGQCSGDSGGPL--------IYNGQQVGIVSWSIKPCTVAPYPGVYCKVSQYVDWIKSN 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ST14NP_068813.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20
SEA 88..>162 CDD:460188
CUB 227..332 CDD:238001
CUB 340..444 CDD:238001
LDLa 454..486 CDD:238060
LDLa 488..523 CDD:238060
LDLa 525..559 CDD:238060
LDLa 567..602 CDD:238060
Tryp_SPc 615..852 CDD:238113 78/250 (31%)
CG12951NP_649880.1 Tryp_SPc 30..260 CDD:238113 78/250 (31%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.