DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ST14 and CG3650

DIOPT Version :10

Sequence 1:NP_068813.1 Gene:ST14 / 6768 HGNCID:11344 Length:855 Species:Homo sapiens
Sequence 2:NP_611971.1 Gene:CG3650 / 37974 FlyBaseID:FBgn0035070 Length:249 Species:Drosophila melanogaster


Alignment Length:262 Identity:81/262 - (30%)
Similarity:124/262 - (47%) Gaps:51/262 - (19%)


- Green bases have known domain annotations that are detailed below.


Human   605 GLRSFTRQARVVGGTDADEGEWPWQVSLHALGQGHI----------CGASLISPNWLVSAAHCYI 659
            ||.|...|.|:||||         ..:|.|:| |.:          ||.||::.:.:|:||||. 
  Fly    16 GLASGQIQPRIVGGT---------TTTLSAVG-GFVVNLRYDGTFYCGGSLVTSSHVVTAAHCL- 69

Human   660 DDRGFRYSDPTQWTAFLGLHDQSQRSAPGVQERRLKRIISHPFFNDFTFDYDIALLELEKPAEYS 724
              :|::.|   :.|...|:   |:.|..|| .||:.|......|:..:.::|:.::.|:.....|
  Fly    70 --KGYQAS---RITVQGGV---SKLSQSGV-VRRVARYFIPNGFSSSSLNWDVGVIRLQSALTGS 125

Human   725 SMVR-PICLPDASHVFPAGKAIWVTGWGHTQYGGTG-ALILQKGEIRVINQTTCENLLP--QQIT 785
            .:.. |:|...    :..|..:.|:|||.|:||.:. :..|:...|::|.:..|:....  ..:|
  Fly   126 GITTIPLCQVQ----WNPGNYMRVSGWGTTRYGNSSPSNQLRTVRIQLIRKKVCQRAYQGRDTLT 186

Human   786 PRMMCVGFLSGGVDSCQGDSGGPLSSVEADGRIFQ---AGVVSWGDGCAQRNKPGVYTRLPLFRD 847
            ....|.  .:||.|||.|||||        |.||:   .|:||||.|||....|||||.:...|.
  Fly   187 ASTFCA--RTGGKDSCSGDSGG--------GVIFKNQLCGIVSWGLGCANAQYPGVYTSVHRVRS 241

Human   848 WI 849
            :|
  Fly   242 FI 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ST14NP_068813.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20
SEA 88..>162 CDD:460188
CUB 227..332 CDD:238001
CUB 340..444 CDD:238001
LDLa 454..486 CDD:238060
LDLa 488..523 CDD:238060
LDLa 525..559 CDD:238060
LDLa 567..602 CDD:238060
Tryp_SPc 615..852 CDD:238113 76/252 (30%)
CG3650NP_611971.1 Tryp_SPc 25..243 CDD:214473 76/251 (30%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.