DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ST14 and CG31954

DIOPT Version :10

Sequence 1:NP_068813.1 Gene:ST14 / 6768 HGNCID:11344 Length:855 Species:Homo sapiens
Sequence 2:NP_722915.1 Gene:CG31954 / 33572 FlyBaseID:FBgn0051954 Length:277 Species:Drosophila melanogaster


Alignment Length:249 Identity:98/249 - (39%)
Similarity:138/249 - (55%) Gaps:28/249 - (11%)


- Green bases have known domain annotations that are detailed below.


Human   614 RVVGG-----TDADEGEWPWQVSLHALGQGHICGASLISPNWLVSAAHCYIDDRGFRYSDPTQWT 673
            |:|||     |||     |.||||..  ..||||.|:||..|:::||||.......|        
  Fly    50 RIVGGHRINITDA-----PHQVSLQT--SSHICGGSIISEEWILTAAHCTYGKTADR-------- 99

Human   674 AFLGLHDQSQRSAPGVQERRLKRIISHPFFNDFTFDYDIALLELEKPAEYSSMVRPICLPDASHV 738
              |.:...:...|...|..|:::|:.|..||....|||.:||:|..|.::....:.:.||::...
  Fly   100 --LKVRLGTSEFARSGQLLRVQKIVQHAQFNYTNVDYDFSLLQLAHPIKFDETKKAVKLPESQMK 162

Human   739 FPAGKAIWVTGWGHTQYGGTGALILQKGEIRVINQTTCENLLPQQ--ITPRMMCVGFLSGGVDSC 801
            :..|:|.:|:|||:||........|::.|:.::||..|.....|.  :|.||:|.|||.||.|:|
  Fly   163 YMDGEACFVSGWGNTQNLLESREWLRQVEVPLVNQELCSEKYKQYGGVTERMICAGFLEGGKDAC 227

Human   802 QGDSGGPLSSVEADGRIFQAGVVSWGDGCAQRNKPGVYTRLPLFRDWIKENTGV 855
            |||||||:  |...|.:  .||||||.|||:.:.||||:|:...||||||::||
  Fly   228 QGDSGGPM--VSESGEL--VGVVSWGYGCAKPDYPGVYSRVSFARDWIKEHSGV 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ST14NP_068813.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20
SEA 88..>162 CDD:460188
CUB 227..332 CDD:238001
CUB 340..444 CDD:238001
LDLa 454..486 CDD:238060
LDLa 488..523 CDD:238060
LDLa 525..559 CDD:238060
LDLa 567..602 CDD:238060
Tryp_SPc 615..852 CDD:238113 94/243 (39%)
CG31954NP_722915.1 Tryp_SPc 51..274 CDD:238113 94/243 (39%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.