DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ST14 and CG32376

DIOPT Version :10

Sequence 1:NP_068813.1 Gene:ST14 / 6768 HGNCID:11344 Length:855 Species:Homo sapiens
Sequence 2:NP_729271.1 Gene:CG32376 / 318002 FlyBaseID:FBgn0052376 Length:291 Species:Drosophila melanogaster


Alignment Length:243 Identity:83/243 - (34%)
Similarity:129/243 - (53%) Gaps:26/243 - (10%)


- Green bases have known domain annotations that are detailed below.


Human   614 RVVGGTDADEGEWPWQVSLHALGQGHICGASLISPNWLVSAAHCYIDDRGFRYSDPTQWTAFLGL 678
            |:|.|......|.|:|.|||..|. .:||..:|:..|:::|.||:       :..|.::|..:| 
  Fly    65 RIVNGKRIPCTEAPFQGSLHYEGY-FVCGCVIINKIWILTAHHCF-------FGPPEKYTVRVG- 120

Human   679 HDQSQRSAPGVQERRLKRIISHPFFNDFTFDYDIALLELEKPAEYSSMVRPICLPDASHV-FPAG 742
            .||.:|   |.|.|.:|:|::...:||:|..:|:|:::|:.|..:...|||:.||..... ||  
  Fly   121 SDQQRR---GGQLRHVKKIVALAAYNDYTMRHDLAMMKLKSPVYFGKCVRPVKLPSTKTTKFP-- 180

Human   743 KAIWVTGWGHTQYGGTGA-LILQKGEIRVINQTTCENLLPQ---QITPRMMCVGFLSGGVDSCQG 803
            |...|:|||.|....... ..|::.:|..|.::.|:.:..:   :|...|:|..  ....|||.|
  Fly   181 KKFVVSGWGITSANAQNVQRYLRRVQIDYIKRSKCQKMYKKAGLKIYKDMICAS--RTNKDSCSG 243

Human   804 DSGGPLSSVEADGRIFQAGVVSWGDGCAQRNKPGVYTRLPLFRDWIKE 851
            ||||||:|   .|.::  |:||||.|||.:|.||||.....:..|||:
  Fly   244 DSGGPLTS---RGVLY--GIVSWGIGCANKNYPGVYVNCKRYVPWIKK 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ST14NP_068813.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20
SEA 88..>162 CDD:460188
CUB 227..332 CDD:238001
CUB 340..444 CDD:238001
LDLa 454..486 CDD:238060
LDLa 488..523 CDD:238060
LDLa 525..559 CDD:238060
LDLa 567..602 CDD:238060
Tryp_SPc 615..852 CDD:238113 82/242 (34%)
CG32376NP_729271.1 Tryp_SPc 65..284 CDD:214473 80/239 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.