DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ST14 and CG30287

DIOPT Version :10

Sequence 1:NP_068813.1 Gene:ST14 / 6768 HGNCID:11344 Length:855 Species:Homo sapiens
Sequence 2:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster


Alignment Length:262 Identity:78/262 - (29%)
Similarity:121/262 - (46%) Gaps:43/262 - (16%)


- Green bases have known domain annotations that are detailed below.


Human   614 RVVGGTDADEGEWPWQVSLHALGQGHICGASLISPNWLVSAAHCYIDDRGFRYSDPTQWTAFLGL 678
            ||:.|..||....||.|.:...|... ||.|||:|.::::||||..:.:       :|.|..||.
  Fly    41 RVINGKPADLFSNPWMVIIIERGMMK-CGGSLITPRYVLTAAHCKSETK-------SQLTVRLGD 97

Human   679 HDQSQR-------SAPGVQERRLKRIISHPFFNDFTFDYDIALLELEKPAEYSSMVRPICLPDAS 736
            :|.:|.       ..|..:|..:.|......:.:|..: |||||.||...:|...:|.|||    
  Fly    98 YDVNQAVDCSSYGCIPRPREINVTRTYVPSHYTNFRKN-DIALLRLETTVQYGDNIRSICL---- 157

Human   737 HVFPAGKAIW------------VTGWGHTQYGGTGALILQKGEIRVINQTTCENLLPQQITPRMM 789
               ..|...|            .||||.|: ....:.:||:..:...:.:.|..:..:|:....:
  Fly   158 ---LMGDYTWSSNILKNLVKFNTTGWGRTE-SRINSPVLQQASLTHHHLSYCAQVFGKQLDKSHI 218

Human   790 CVGFLSGGVDSCQGDSGGPLSS---VEADGRIFQAGVVSWGDGCAQRNKPGVYTRLPLFRDWIKE 851
            ||...:|  .:|||||||||::   :.::.|:...||||:  |......|.|||.:..|.:||:.
  Fly   219 CVASSTG--STCQGDSGGPLTARVRIGSERRVILFGVVSY--GAVHCFGPTVYTNVIHFANWIEL 279

Human   852 NT 853
            :|
  Fly   280 HT 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ST14NP_068813.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20
SEA 88..>162 CDD:460188
CUB 227..332 CDD:238001
CUB 340..444 CDD:238001
LDLa 454..486 CDD:238060
LDLa 488..523 CDD:238060
LDLa 525..559 CDD:238060
LDLa 567..602 CDD:238060
Tryp_SPc 615..852 CDD:238113 76/258 (29%)
CG30287NP_726083.1 Tryp_SPc 42..280 CDD:238113 76/258 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.