DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ST14 and CG30082

DIOPT Version :10

Sequence 1:NP_068813.1 Gene:ST14 / 6768 HGNCID:11344 Length:855 Species:Homo sapiens
Sequence 2:NP_001188942.1 Gene:CG30082 / 246443 FlyBaseID:FBgn0050082 Length:280 Species:Drosophila melanogaster


Alignment Length:268 Identity:88/268 - (32%)
Similarity:119/268 - (44%) Gaps:40/268 - (14%)


- Green bases have known domain annotations that are detailed below.


Human   601 DCDCGLR-SFTRQARVVGGTDADEGEWPWQVSLHALGQGHICGASLISPNWLVSAAHCYIDDRGF 664
            |.:||.. :.....|:|||..||.|..||...||. ....:|..:||:..::::||||.   ..|
  Fly    25 DPNCGTTINLPPTNRIVGGRTADIGSNPWLAYLHK-NSSLVCTGTLITKRFVLTAAHCL---HSF 85

Human   665 RYSDPTQWTAFLGLHDQSQR-------SAPGVQERRLKRIISHPFF-------NDFTFDYDIALL 715
            ..     .|..||.:|.|.|       ..|..:|..::....|.||       |      ||.||
  Fly    86 HL-----LTVRLGEYDTSTRIDCTSEFCIPTYEEYSVENAYIHTFFGGRQDSRN------DIGLL 139

Human   716 ELEKPAEYSSMVRPICL-PDASHVFPAGKAIWVTGWGHTQYGGTGALILQKGEIRVINQTTCENL 779
            :|.....|...:||||| .|...| |........|||......| |.:||...:..::|:.||..
  Fly   140 KLNGTVVYKLFIRPICLFRDPGQV-PYSSTYEAAGWGKIDLINT-ATVLQTVNLIRLDQSDCERS 202

Human   780 LPQQITPRMMCVGFLSGGVDSCQGDSGGPLSSVEADGRI---FQAGVVSWGDGCAQRNKPGVYTR 841
            |...::....|.|  ....|:|.||||||||...::|||   .|.|:||:|....:  .|||||.
  Fly   203 LRTSLSYGQFCAG--QWRADTCSGDSGGPLSRKMSNGRITRTVQLGIVSYGHYLCR--GPGVYTY 263

Human   842 LPLFRDWI 849
            :|.|.:||
  Fly   264 VPSFTNWI 271

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
ST14NP_068813.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20
SEA 88..>162 CDD:460188
CUB 227..332 CDD:238001
CUB 340..444 CDD:238001
LDLa 454..486 CDD:238060
LDLa 488..523 CDD:238060
LDLa 525..559 CDD:238060