DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BRDT and tbrd-3

DIOPT Version :9

Sequence 1:NP_001229735.2 Gene:BRDT / 676 HGNCID:1105 Length:951 Species:Homo sapiens
Sequence 2:NP_726307.1 Gene:tbrd-3 / 246604 FlyBaseID:FBgn0050417 Length:268 Species:Drosophila melanogaster


Alignment Length:315 Identity:81/315 - (25%)
Similarity:129/315 - (40%) Gaps:74/315 - (23%)


- Green bases have known domain annotations that are detailed below.


Human   269 KTVKVTEQLRHCSEILKEMLAKKHFSYAWPFYNPVDVNALGLHNYYDVVKNPMDLGTIKEKMDNQ 333
            :|.:.:.::..|..|:|.:.:..:.:.||.||.|:|...||||:|:::|:.||||.|::.:::..
  Fly     6 ETERSSPEINACKVIIKRLFSSTYKNIAWVFYEPLDPQLLGLHDYHEIVREPMDLSTVRHRLNTG 70

Human   334 EYKDAYKFAADVRLMFMNCYKYNPPDHEVVTMARMLQDVFETHFSKIPIEPVESMPLCYIKTDIT 398
            .|..|..||.|:||:|.|.|.|..|||....||:.||.:||..:|::.:         ||.:..:
  Fly    71 CYLSAADFAKDIRLIFYNTYLYTNPDHLCYHMAKQLQIIFEEMYSQVQL---------YICSSGS 126

Human   399 ETTGRENTNEASSEGNSSDDSEDERVKRLAKLQEQLKAVHQQLQVLSQVPFRKLNKKKEKSKKEK 463
            :....|   |:||:.:.|...|||                                         
  Fly   127 KVRAEE---ESSSDESDSSSPEDE----------------------------------------- 147

Human   464 KKEKVNNSNENPRKM-----CEQMRLKEKSKRNQPKKRKQQFIGLKSEDEDNAKPMNYDEKRQLS 523
                ||.|..:|..|     |........:....|.        ...|..:..:|...:|...|.
  Fly   148 ----VNGSEVSPSIMGAPPSCTPTTECTPTPDWTPP--------ATLETSEQQEPFTTEEDLDLH 200

Human   524 LNINKLPGDKLGRVVHIIQSRE-PSLSNSNPDEIEIDFETLKASTLRELEKYVSA 577
            ..|.:|.|:.|..|:|.||..| ....|.   |:|.|...||..|.|.:..|:::
  Fly   201 AKIQQLDGEVLLHVIHFIQRMEGAEYCNK---ELEFDICKLKVHTKRGIRDYLAS 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BRDTNP_001229735.2 Bromo_Brdt_I_like 27..133 CDD:99929
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 206..232
Nuclear localization signal. /evidence=ECO:0000269|PubMed:22971749 213..224
Bromo_Brdt_II_like 276..377 CDD:99930 40/100 (40%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 399..424 8/24 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 448..515 9/71 (13%)
BET 513..575 CDD:293640 20/62 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 614..702
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 886..928
BRD4_CDT 909..951 CDD:293710
tbrd-3NP_726307.1 Bromo_Brdt_II_like 13..114 CDD:99930 40/100 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000322
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22880
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X197
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.