DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SSTR5 and AstC-R1

DIOPT Version :9

Sequence 1:NP_001044.1 Gene:SSTR5 / 6755 HGNCID:11334 Length:364 Species:Homo sapiens
Sequence 2:NP_649040.2 Gene:AstC-R1 / 40020 FlyBaseID:FBgn0036790 Length:483 Species:Drosophila melanogaster


Alignment Length:296 Identity:132/296 - (44%)
Similarity:176/296 - (59%) Gaps:21/296 - (7%)


- Green bases have known domain annotations that are detailed below.


Human    45 VLYLLVCAAGLGGNTLVIYVVLRFAKMKTVTNIYILNLAVADVLYMLGLPFLATQNAASFWPFGP 109
            |||..||..||.||||||||||||:||:||||||||||||||..:::|:|||........|.||.
  Fly    82 VLYGFVCIIGLFGNTLVIYVVLRFSKMQTVTNIYILNLAVADECFLIGIPFLLYTMRICSWRFGE 146

Human   110 VLCRLVMTLDGVNQFTSVFCLTVMSVDRYLAVVHPLSSARWRRPRVAKLASAAAWVLSLCMSLPL 174
            .:|:..|....:..|||...|.:||.|||:||.||:||.|:|...:||:.||.||..|..:.||:
  Fly   147 FMCKAYMVSTSITSFTSSIFLLIMSADRYIAVCHPISSPRYRTLHIAKVVSAIAWSTSAVLMLPV 211

Human   175 LVFADV--QEGG---TCNASWPEPVGLW-GAVFIIYTAVLGFFAPLLVICLCYLLIVVKVRAAGV 233
            :::|..  ||.|   :||..||:..... |..||:||..|||..||..|...|.|::.|:|:.|.
  Fly   212 ILYASTVEQEDGINYSCNIMWPDAYKKHSGTTFILYTFFLGFATPLCFILSFYYLVIRKLRSVGP 276

Human   234 RVGC---VRRRSERKVTRMVLVVVLVFAGCWLPFFTVNIVNLAVALPQEPASAGL-------YFF 288
            :.|.   .:||:.|||||:||.|:.|:..||||.:    ::....:...||...|       :..
  Fly   277 KPGTKSKEKRRAHRKVTRLVLTVISVYILCWLPHW----ISQVALIHSNPAQRDLSRLEILIFLL 337

Human   289 VVILSYANSCANPVLYGFLSDNFRQSFQKVL-CLRK 323
            :..|.|:||..||:||.|||:|||:||.|.. |:.|
  Fly   338 LGALVYSNSAVNPILYAFLSENFRKSFFKAFTCMNK 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SSTR5NP_001044.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20
7tm_4 54..319 CDD:304433 125/280 (45%)
7tm_1 57..304 CDD:278431 112/262 (43%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 327..364
AstC-R1NP_649040.2 7tm_4 88..368 CDD:304433 126/283 (45%)
7tm_1 94..353 CDD:278431 112/262 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 223 1.000 Domainoid score I2578
eggNOG 1 0.900 - - E33208_3BCR0
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 243 1.000 Inparanoid score I3312
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000463
OrthoInspector 1 1.000 - - mtm8609
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24229
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3938
SonicParanoid 1 1.000 - - X22
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
109.990

Return to query results.
Submit another query.