DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SSRP1 and tHMG1

DIOPT Version :10

Sequence 1:XP_016873669.2 Gene:SSRP1 / 6749 HGNCID:11327 Length:875 Species:Homo sapiens
Sequence 2:NP_651055.1 Gene:tHMG1 / 42650 FlyBaseID:FBgn0038978 Length:126 Species:Drosophila melanogaster


Alignment Length:69 Identity:29/69 - (42%)
Similarity:49/69 - (71%) Gaps:1/69 - (1%)


- Green bases have known domain annotations that are detailed below.


Human   713 PKRPMSAYMLWLNAS-REKIKSDHPGISITDLSKKAGEIWKGMSKEKKEEWDRKAEDARRDYEKA 776
            ||:||||:|||:|:: |:.||::||..|:.::|.|.||:|:.|:.|.|..|...|..|..:|::.
  Fly     8 PKKPMSAFMLWMNSTGRKHIKAEHPDFSVQEVSVKGGEMWRAMADEDKIVWQESATTAMAEYKEK 72

Human   777 MKEY 780
            :|::
  Fly    73 LKQW 76

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SSRP1XP_016873669.2 POB3 187..646 CDD:227494
HMG-box_SSRP1-like 715..781 CDD:438810 27/67 (40%)
tHMG1NP_651055.1 HMG_box 8..76 CDD:459837 29/67 (43%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.