DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SRY and Sox15

DIOPT Version :9

Sequence 1:NP_003131.1 Gene:SRY / 6736 HGNCID:11311 Length:204 Species:Homo sapiens
Sequence 2:NP_523739.2 Gene:Sox15 / 36575 FlyBaseID:FBgn0005613 Length:784 Species:Drosophila melanogaster


Alignment Length:201 Identity:60/201 - (29%)
Similarity:96/201 - (47%) Gaps:38/201 - (18%)


- Green bases have known domain annotations that are detailed below.


Human    35 LCTESC-----------NSKYQCETGENSKGNVQDRVKRPMNAFIVWSRDQRRKMALENPRMRNS 88
            ||..:|           :.||: ..|..||...:.|::||||||:||::.:|:|:|.|||.:.|:
  Fly   180 LCAPNCGYLERHKPLPADLKYR-PGGTQSKSAKESRIRRPMNAFMVWAKIERKKLADENPDLHNA 243

Human    89 EISKQLGYQWKMLTEAEKWPFFQEAQKLQAMHREKYPNYKYRPRRKAK-----MLP--------- 139
            ::||.||.:|:.||..::.|:.:||::|:.:|..::|||||||||:.:     |.|         
  Fly   244 DLSKMLGKKWRSLTPQDRRPYVEEAERLRVIHMTEHPNYKYRPRRRKQSKLRAMQPGGKEQSESS 308

Human   140 --------KNCSLLPADPASVLCSEVQLDNRLYRDDCTKATHSRMEHQLGHL--PPINAASSPQQ 194
                    |:...|...|.:...|.......  ...|.....:..:...|.|  .|:....||..
  Fly   309 PNPGTGGSKSNPKLATPPLATASSSYTTPTD--ESTCNSTNQNHGQSTPGGLYEQPLKPTYSPSS 371

Human   195 RDRYSH 200
            .|.||:
  Fly   372 VDCYSN 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SRYNP_003131.1 Sufficient for interaction with KPNB1. /evidence=ECO:0000269|PubMed:15297880 59..136 37/76 (49%)
SOX-TCF_HMG-box 59..130 CDD:238684 32/70 (46%)
Required for nuclear localization. /evidence=ECO:0000269|PubMed:12764225, ECO:0000269|PubMed:15746192 61..77 9/15 (60%)
Sufficient for interaction with EP300. /evidence=ECO:0000269|PubMed:15297880 107..139 15/36 (42%)
Required for nuclear localization. /evidence=ECO:0000269|PubMed:15297880 130..136 4/5 (80%)
Necessary for interaction with ZNF208 isoform KRAB-O. /evidence=ECO:0000269|PubMed:15469996 138..155 4/33 (12%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 175..204 8/28 (29%)
Necessary for interaction with SLC9A3R2. /evidence=ECO:0000269|PubMed:9054412 198..204 2/3 (67%)
Sox15NP_523739.2 SOX-TCF_HMG-box 214..285 CDD:238684 32/70 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165148469
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10270
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.