DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ascl4 and CG33557

DIOPT Version :9

Sequence 1:NP_001157086.1 Gene:Ascl4 / 67341 MGIID:1914591 Length:144 Species:Mus musculus
Sequence 2:NP_001014730.1 Gene:CG33557 / 3346145 FlyBaseID:FBgn0053557 Length:150 Species:Drosophila melanogaster


Alignment Length:75 Identity:31/75 - (41%)
Similarity:37/75 - (49%) Gaps:15/75 - (20%)


- Green bases have known domain annotations that are detailed below.


Mouse    43 RRRPYSSLPLGGVAEPAFLRQR-NERERQRVRCVNEGYARLRQHLPRELAGQRLSKVETLRAAIS 106
            ||||           |   ||: |.|||.|...||..|..||..:|.|...::|||:|.:|.|.|
  Fly    58 RRRP-----------P---RQKINARERYRTFNVNSAYEALRNLIPTEPMNRKLSKIEIIRLASS 108

Mouse   107 YIKQLQELLE 116
            ||..|...||
  Fly   109 YITHLSSTLE 118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ascl4NP_001157086.1 HLH 72..116 CDD:197674 17/43 (40%)
CG33557NP_001014730.1 HLH 67..119 CDD:197674 24/52 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.